Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetHIV WT-B pol protein (wild-type clade B)
LigandBDBM577
Substrate/Competitorn/a
Meas. Tech.Drug Susceptibility Assay
EC50 1.8±0.0 nM
Citation Shen YAltman MDAli ANalam MNCao HRana TMSchiffer CATidor B Testing the substrate-envelope hypothesis with designed pairs of compounds. ACS Chem Biol 8:2433-41 (2013) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
HIV WT-B pol protein (wild-type clade B)
Name:HIV WT-B pol protein (wild-type clade B)
Synonyms:WT-B
Type:Protein
Mol. Mass.:45584.13
Organism:Human immunodeficiency virus
Description:n/a
Residue:401
Sequence:
PQITLWQRPLVTIKIGGQLKEALLDTGADDTVLEEMHLPGKWKPKMIGGIGGFIKVRQYD
QILIEICGHKAIGTVLIGPTPVNIIGRNLLTQLGCTLNFPISPIETVPVKLKPGMDGPKV
KQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPIFAIKKKDSTKWRKLVDFRELN
KRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPLDKDFRKYTAFTIPSVNNETPG
IRYQYNVLPQGWKGSPAIFQSSMTKILEPFRQNPDIVIYQYMDDLYVGSDLEIGQHRAKI
EELREHLLWGTTPDKKHQKEPPFLWMGYELHPDKWTVQPIVLPEKDSWTVNDIQKLVGKL
NWASQIYAGIKVRQLCKLLRGAKALTEVIQLTEEAELELAE
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM577
n/a
NameBDBM577
Synonyms:(3S)-oxolan-3-yl N-[(2S,3R)-4-[(4-aminobenzene)(2-methylpropyl)sulfonamido]-3-hydroxy-1-phenylbutan-2-yl]carbamate | 141W94 | APV | Agenerase | Amprenavir | CHEMBL116 | VX-478
TypeSmall organic molecule
Emp. Form.n/a
Mol. Mass.n/a
SMILESn/a
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: