| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Arachidonate 5-lipoxygenase-activating protein |
|---|
| Ligand | BDBM104518 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | Binding Assay |
|---|
| IC50 | 2.9±0.0 nM |
|---|
| Citation |  Bartolozzi, A; Bosanac, T; Chen, Z; De Lombaert, S; Dines, JA; Huber, JD; Liu, WW; Loke, PL; Morwick, TM; Olague, A; Riether, D; Tye, H; Wu, L; Zindell, RM Oxadiazole inhibitors of leukotriene production US Patent US8575201 Publication Date 11/5/2013 |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Arachidonate 5-lipoxygenase-activating protein |
|---|
| Name: | Arachidonate 5-lipoxygenase-activating protein |
|---|
| Synonyms: | 5-lipoxygenase activating protein | 5-lipoxygenase-activating protein (FLAP) | 5-lipoxygenase/FLAP | AL5AP_HUMAN | ALOX5AP | FLAP | MK-886-binding protein |
|---|
| Type: | Enzyme |
|---|
| Mol. Mass.: | 18159.90 |
|---|
| Organism: | Homo sapiens (Human) |
|---|
| Description: | P20292 |
|---|
| Residue: | 161 |
|---|
| Sequence: | MDQETVGNVVLLAIVTLISVVQNGFFAHKVEHESRTQNGRSFQRTGTLAFERVYTANQNC
VDAYPTFLAVLWSAGLLCSQVPAAFAGLMYLFVRQKYFVGYLGERTQSTPGYIFGKRIIL
FLFLMSVAGIFNYYLIFFFGSDFENYIKTISTTISPLLLIP
|
|
|
|---|
| BDBM104518 |
|---|
| n/a |
|---|
| Name | BDBM104518 |
|---|
| Synonyms: | US8575201, 9 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C23H22N8O |
|---|
| Mol. Mass. | 426.4738 |
|---|
| SMILES | Nc1ncc(cn1)-c1ccc(cn1)C1(CCC1)c1noc(n1)-c1ccc(NC2CC2)nc1 |
|---|
| Structure | 
|
|---|
Search and Browse
