Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetOrexin receptor type 2 (OX2)
LigandBDBM104706
Substrate/Competitorn/a
Meas. Tech.Radioligand Binding Assay
Ki 0.67±0.0 nM
Citation Breslin MJColeman PJCox CDSchreier JD Pyridyl piperidine orexin receptor antagonists US Patent  US8569311 Publication Date 10/29/2013
More Info.:Get all data from this article,  Assay Method
 
Orexin receptor type 2 (OX2)
Name:Orexin receptor type 2 (OX2)
Synonyms:Hcrtr2 | Hypocretin receptor type 2 | Orexin receptor type 2 (OX2R) | Ox-2-R | Ox2-R | Ox2R
Type:Protein
Mol. Mass.:52508.46
Organism:Rattus norvegicus (Rat)
Description:P56719
Residue:460
Sequence:
MSSTKLEDSLPRRNWSSASELNETQEPFLNPTDYDDEEFLRYLWREYLHPKEYEWVLIAG
YIIVFVVALIGNVLVCVAVWKNHHMRTVTNYFIVNLSLADVLVTITCLPATLVVDITETW
FFGQSLCKVIPYLQTVSVSVSVLTLSCIALDRWYAICHPLMFKSTAKRARNSIVVIWIVS
CIIMIPQAIVMERSSMLPGLANKTTLFTVCDERWGGEVYPKMYHICFFLVTYMAPLCLMV
LAYLQIFRKLWCRQIPGTSSVVQRKWKQPQPVSQPRGSGQQSKARISAVAAEIKQIRARR
KTARMLMVVLLVFAICYLPISILNVLKRVFGMFTHTEDRETVYAWFTFSHWLVYANSAAN
PIIYNFLSGKFREEFKAAFSCCLGVHRRQGDRLARGRTSTESRKSLTTQISNFDNVSKLS
EHVALTSISTLPAANGAGPLQNWYLQQGVPSSLLSTWLEV
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM104706
n/a
NameBDBM104706
Synonyms:US8569311, 1-28
TypeSmall organic molecule
Emp. Form.C23H23FN4O2
Mol. Mass.406.4527
SMILESC[C@@H]1CC[C@@H](COc2ccc(F)cn2)CN1C(=O)c1ccccc1-c1ncccn1 |r|
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: