| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Retinol-binding protein 4 |
|---|
| Ligand | BDBM106688 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | Binding Assay |
|---|
| IC50 | 20±0.0 nM |
|---|
| Citation |  Kasai, S; Kaku, T; Kamaura, M Heterocyclic compound US Patent US8586571 Publication Date 11/19/2013 |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Retinol-binding protein 4 |
|---|
| Name: | Retinol-binding protein 4 |
|---|
| Synonyms: | PRBP | Plasma retinol-binding protein | RBP | RBP4 | RET4_HUMAN | Retinol-binding protein 4 | Retinol-binding protein 4 (RBP4) | spa binding assay for rbp4 |
|---|
| Type: | Protein |
|---|
| Mol. Mass.: | 23008.75 |
|---|
| Organism: | Homo sapiens (Human) |
|---|
| Description: | P02753 |
|---|
| Residue: | 201 |
|---|
| Sequence: | MKWVWALLLLAALGSGRAERDCRVSSFRVKENFDKARFSGTWYAMAKKDPEGLFLQDNIV
AEFSVDETGQMSATAKGRVRLLNNWDVCADMVGTFTDTEDPAKFKMKYWGVASFLQKGND
DHWIVDTDYDTYAVQYSCRLLNLDGTCADSYSFVFSRDPNGLPPEAQKIVRQRQEELCLA
RQYRLIVHNGYCDGRSERNLL
|
|
|
|---|
| BDBM106688 |
|---|
| n/a |
|---|
| Name | BDBM106688 |
|---|
| Synonyms: | US8586571, 80 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C17H22FNO4 |
|---|
| Mol. Mass. | 323.3593 |
|---|
| SMILES | CC(C)(C)c1cc(F)ccc1OC1CN(C1)C(=O)CCC(O)=O |
|---|
| Structure | 
|
|---|
Search and Browse
