| Reaction Details |
|---|
 | Report a problem with these data |
| Target | 5-hydroxytryptamine 1D receptor |
|---|
| Ligand | BDBM106707 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | Binding Assay |
|---|
| IC50 | 48±n/a nM |
|---|
| Citation |  Maddaford, S; Ramnauth, J; Rakhit, S; Patman, J; Renton, P; Annedi, SC Substituted indole compounds having NOS inhibitory activity US Patent US8586620 Publication Date 11/19/2013 |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| 5-hydroxytryptamine 1D receptor |
|---|
| Name: | 5-hydroxytryptamine 1D receptor |
|---|
| Synonyms: | 5-hydroxytryptamine 1D receptor (5HT1D) | HTR1D |
|---|
| Type: | Protein |
|---|
| Mol. Mass.: | 12731.52 |
|---|
| Organism: | Bos taurus (Bovine) |
|---|
| Description: | Q8MI13 |
|---|
| Residue: | 119 |
|---|
| Sequence: | SNRSLNATATQGAWDPGTLQALKIALVVLLSIITLATVLSNAFVLTTIFLTRKLHTPANC
LIGSLAMTDLLVSILVMPISIAYTTTHTWSFGQLLCDIWLSSDITCCTASILHLCVIAL
|
|
|
|---|
| BDBM106707 |
|---|
| n/a |
|---|
| Name | BDBM106707 |
|---|
| Synonyms: | CHEMBL1957358 | US8586620, 67 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C17H22N4S |
|---|
| Mol. Mass. | 314.448 |
|---|
| SMILES | CCSC(N)=Nc1ccc2[nH]cc(C3=CCN(C)CC3)c2c1 |w:5.5,t:13| |
|---|
| Structure | 
|
|---|
Search and Browse
