| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Gag-Pol polyprotein [1148-1435] |
|---|
| Ligand | BDBM50056898 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | HIV-1 Integrase Assay |
|---|
| IC50 | 7e+2±n/a nM |
|---|
| Citation |  Bhatt, H; Patel, P; Pannecouque, C Discovery of HIV-1 integrase inhibitors: pharmacophore mapping, virtual screening, molecular docking, synthesis, and biological evaluation. Chem Biol Drug Des83:154-66 (2014) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Gag-Pol polyprotein [1148-1435] |
|---|
| Name: | Gag-Pol polyprotein [1148-1435] |
|---|
| Synonyms: | HIV-1 Integrase | POL_HV1H2 | gag-pol |
|---|
| Type: | Enzyme |
|---|
| Mol. Mass.: | 32171.42 |
|---|
| Organism: | Human immunodeficiency virus type 1 |
|---|
| Description: | The sequence encoding the 288-amino-acid wild-type full-length integrase was cloned with an N-terminal 6His tag, and expressed in E. coli. |
|---|
| Residue: | 288 |
|---|
| Sequence: | FLDGIDKAQDEHEKYHSNWRAMASDFNLPPVVAKEIVASCDKCQLKGEAMHGQVDCSPGI
WQLDCTHLEGKVILVAVHVASGYIEAEVIPAETGQETAYFLLKLAGRWPVKTIHTDNGSN
FTGATVRAACWWAGIKQEFGIPYNPQSQGVVESMNKELKKIIGQVRDQAEHLKTAVQMAV
FIHNFKRKGGIGGYSAGERIVDIIATDIQTKELQKQITKIQNFRVYYRDSRNPLWKGPAK
LLWKGEGAVVIQDNSDIKVVPRRKAKIIRDYGKQMAGDDCVASRQDED
|
|
|
|---|
| BDBM50056898 |
|---|
| n/a |
|---|
| Name | BDBM50056898 |
|---|
| Synonyms: | 2-Hydroxy-benzoic acid N'-(2-hydroxy-benzyl)-hydrazide | 2-hydroxy-N'-[(2- hydroxyphenyl)methyl]benzohydrazide (Compound 4) | CHEMBL433983 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C14H14N2O3 |
|---|
| Mol. Mass. | 258.2726 |
|---|
| SMILES | Oc1ccccc1CNNC(=O)c1ccccc1O |
|---|
| Structure | 
|
|---|
Search and Browse
