| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Cyclin-dependent kinase 4 |
|---|
| Ligand | BDBM107760 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | Enzymatic Activity Assay |
|---|
| pH | 7.5±0 |
|---|
| IC50 | 548±n/a nM |
|---|
| Citation |  Howard, S; Mortenson, PN; Hiscock, SD; Woolford, AJ; Woodhead, AJ; Chessari, G; O'Reilly, M; Congreve, MS; Dagostin, C; Cho, YS; Yang, F; Chen, CH; Brain, CT; Lagu, B; Wang, Y; Kim, S; Giraldes, J; Luzzio, MJ; Perez, LB Imidazole derivatives and their use as modulators of cyclin dependent kinases US Patent US8598217 Publication Date 12/3/2013 |
|---|
| More Info.: | Get all data from this article, Solution Info, Assay Method |
|---|
| |
| Cyclin-dependent kinase 4 |
|---|
| Name: | Cyclin-dependent kinase 4 |
|---|
| Synonyms: | Cyclin-dependent kinase 4 (CDK4) |
|---|
| Type: | Enzyme |
|---|
| Mol. Mass.: | 21063.86 |
|---|
| Organism: | Oryctolagus cuniculus (Rabbit) |
|---|
| Description: | Q0GMK6 |
|---|
| Residue: | 189 |
|---|
| Sequence: | HFVALKSVRVPNGGGAGGGLPISTVREVALLRRLEAFEHPNVVRLMDVCATSRTDREIKV
TLVFEHVDQDLRTYLDKAPPPGLPAETIKDLMCQFLRGLDFLHANCIVHRDLKPENILVT
SSGTVKLADFGLARIYSYQMALTPVVVTLWYRAPEVLLQSTYATPVDMWSAGCIFAEMFR
RKPLFCGNS
|
|
|
|---|
| BDBM107760 |
|---|
| n/a |
|---|
| Name | BDBM107760 |
|---|
| Synonyms: | US8598217, 170 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C22H24N8O |
|---|
| Mol. Mass. | 416.479 |
|---|
| SMILES | Cc1n[nH]c(C)c1-c1cc(ccn1)C(=O)c1nc2nc(ccc2[nH]1)N1CCCNCC1 |
|---|
| Structure | 
|
|---|
Search and Browse
