| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Secreted chorismate mutase |
|---|
| Ligand | BDBM108082 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | CM Assay |
|---|
| Temperature | 310.15±n/a K |
|---|
| IC50 | 2.880e+4± 1.20e+3 nM |
|---|
| Comments | extracted |
|---|
| Citation |  Jeankumar, VU; Alokam, R; Sridevi, JP; Suryadevara, P; Matikonda, SS; Peddi, S; Sahithi, S; Alvala, M; Yogeeswari, P; Sriram, D Discovery and Structure Optimization of a Series of Isatin Derivatives as Mycobacterium tuberculosis Chorismate Mutase Inhibitors. Chem Biol Drug Des83:498-506 (2014) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Secreted chorismate mutase |
|---|
| Name: | Secreted chorismate mutase |
|---|
| Synonyms: | Chorismate mutase (CM) | Chorismate mutase (MTB CM) | Chorismate mutase-related protein | SCMU_MYCTU |
|---|
| Type: | Protein |
|---|
| Mol. Mass.: | 21942.03 |
|---|
| Organism: | Mycobacterium tuberculosis H37Rv |
|---|
| Description: | n/a |
|---|
| Residue: | 199 |
|---|
| Sequence: | MLTRPREIYLATAVSIGILLSLIAPLGPPLARADGTSQLAELVDAAAERLEVADPVAAFK
WRAQLPIEDSGRVEQQLAKLGEDARSQHIDPDYVTRVFDDQIRATEAIEYSRFSDWKLNP
ASAPPEPPDLSASRSAIDSLNNRMLSQIWSHWSLLSAPSCAAQLDRAKRDIVRSRHLDSL
YQRALTTATQSYCQALPPA
|
|
|
|---|
| BDBM108082 |
|---|
| n/a |
|---|
| Name | BDBM108082 |
|---|
| Synonyms: | 5‐[4‐(furan‐2‐carbonyl)piperazin‐1‐yl]‐1H‐indole‐ 2,3‐dione (Compound 23) |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C17H15N3O4 |
|---|
| Mol. Mass. | 325.3187 |
|---|
| SMILES | O=C(N1CCN(CC1)c1ccc2NC(=O)C(=O)c2c1)c1ccco1 |
|---|
| Structure | 
|
|---|
Search and Browse
