Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetTranscription initiation factor IIA
LigandBDBM108117
Substrate/Competitorn/a
Meas. Tech.Inhibition Assay
Ki 1200±0.0 nM
Citation Herold PDaghish MJelakovic SLudwig FReichelt CSchulze ASchweinitz A Trypsin-like serine protease inhibitors, and their preparation and use US Patent  US8598206 Publication Date 12/3/2013
More Info.:Get all data from this article,  Assay Method
 
Transcription initiation factor IIA
Name:Transcription initiation factor IIA
Synonyms:n/a
Type:Enzyme
Mol. Mass.:41485.12
Organism:Homo sapiens (Human)
Description:P52655
Residue:376
Sequence:
MANSANTNTVPKLYRSVIEDVINDVRDIFLDDGVDEQVLMELKTLWENKLMQSRAVDGFH
SEEQQLLLQVQQQHQPQQQQHHHHHHHQQAQPQQTVPQQAQTQQVLIPASQQATAPQVIV
PDSKLIQHMNASNMSAAATAATLALPAGVTPVQQILTNSGQLLQVVRAANGAQYIFQPQQ
SVVLQQQVIPQMQPGGVQAPVIQQVLAPLPGGISPQTGVIIQPQQILFTGNKTQVIPTTV
AAPTPAQAQITATGQQQPQAQPAQTQAPLVLQVDGTGDTSSEEDEDEEEDYDDDEEEDKE
KDGAEDGQVEEEPLNSEDDVSDEEGQELFDTENVVVCQYDKIHRSKNKWKFHLKDGIMNL
NGRDYIFSKAIGDAEW
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM108117
n/a
NameBDBM108117
Synonyms:US8598206, Table 6, 2
TypeSmall organic molecule
Emp. Form.C34H45N7O4S
Mol. Mass.647.831
SMILESNC(=N)c1ccc(CNC(=O)[C@H](CCC2CCNCC2)NC(=O)[C@@H](CCCc2ccncc2)NS(=O)(=O)Cc2ccccc2)cc1 |r|
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: