Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
Target1-Deoxy-D-xylulose-5-phosphate synthase (DXP synthase))
LigandBDBM108231
Substrate/Competitorn/a
Meas. Tech.DXP Synthase Inhibition Assay
pH8±n/a
Temperature310.15±n/a K
IC50>2.000e+6± 0 nM
Commentsextracted
Citation Morris FVierling RBoucher LBosch JFreel Meyers CL DXP synthase-catalyzed C-N bond formation: nitroso substrate specificity studies guide selective inhibitor design. Chembiochem 14:1309-15 (2013) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
1-Deoxy-D-xylulose-5-phosphate synthase (DXP synthase))
Name:1-Deoxy-D-xylulose-5-phosphate synthase (DXP synthase))
Synonyms:n/a
Type:Protein
Mol. Mass.:67617.17
Organism:Escherichia coli K-12 (Enterobacteria)
Description:n/a
Residue:620
Sequence:
MSFDIAKYPTLALVDSTQELRLLPKESLPKLCDELRRYLLDSVSRSSGHFASGLGTVELT
VALHYVYNTPFDQLIWDVGHQAYPHKILTGRRDKIGTIRQKGGLHPFPWRGESEYDVLSV
GHSSTSISAGIGIAVAAEKEGKNRRTVCVIGDGAITAGMAFEAMNHAGDIRPDMLVILND
NEMSISENVGALNNHLAQLLSGKLYSSLREGGKKVFSGVPPIKELLKRTEEHIKGMVVPG
TLFEELGFNYIGPVDGHDVLGLITTLKNMRDLKGPQFLHIMTKKGRGYEPAEKDPITFHA
VPKFDPSSGCLPKSSGGLPSYSKIFGDWLCETAAKDNKLMAITPAMREGSGMVEFSRKFP
DRYFDVAIAEQHAVTFAAGLAIGGYKPIVAIYSTFLQRAYDQVLHDVAIQKLPVLFAIDR
AGIVGADGQTHQGAFDLSYLRCIPEMVIMTPSDENECRQMLYTGYHYNDGPSAVRYPRGN
AVGVELTPLEKLPIGKGIVKRRGEKLAILNFGTLMPEAAKVAESLNATLVDMRFVKPLDE
ALILEMAASHEALVTVEENAIMGGAGSGVNEVLMAHRKPVPVLNIGLPDFFIPQGTQEEM
RAELGLDAAGMEAKIKAWLA
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM108231
n/a
NameBDBM108231
Synonyms:7‐methoxy‐1‐nitrosonaphthalen‐2‐ol (Substrate 8)
TypeSmall organic molecule
Emp. Form.C11H9NO3
Mol. Mass.203.1941
SMILESCOc1ccc2ccc(O)c(N=O)c2c1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: