Reaction Details |
| Report a problem with these data |
Target | Histone H1.0 |
---|
Ligand | BDBM21398 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | Binding Assay |
---|
Ki | 780±0.0 nM |
---|
Citation | Mates, S; Fienberg, A; Wennogle, L Methods and compositions for sleep disorders and other disorders US Patent US8598119 Publication Date 12/3/2013 |
---|
More Info.: | Get all data from this article, Assay Method |
---|
|
Histone H1.0 |
---|
Name: | Histone H1.0 |
Synonyms: | H1-0 | H10_HUMAN | H1F0 | H1FV | Histone H1 |
Type: | Cell-surface receptors |
Mol. Mass.: | 20917.09 |
Organism: | Homo sapiens (Human) |
Description: | P07305 |
Residue: | 194 |
Sequence: | MTENSTSAPAAKPKRAKASKKSTDHPKYSDMIVAAIQAEKNRAGSSRQSIQKYIKSHYKV
GENADSQIKLSIKRLVTTGVLKQTKGVGASGSFRLAKSDEPKKSVAFKKTKKEIKKVATP
KKASKPKKAASKAPTKKPKATPVKKAKKKLAATPKKAKKPKTVKAKPVKASKPKKAKPVK
PKAKSSAKRAGKKK
|
|
|
BDBM21398 |
---|
n/a |
---|
Name | BDBM21398 |
Synonyms: | 4-[4-(4-Chloro-phenyl)-4-hydroxy-piperidin-1-yl]-1-(4-fluoro-phenyl)-butan-1-one;propionate(HCl) | 4-[4-(4-chlorophenyl)-4-hydroxypiperidin-1-yl]-1-(4-fluorophenyl)butan-1-one | CHEMBL54 | CHEMBL545608 | Haloperidol | Haloperidol, 1 |
Type | Small organic molecule |
Emp. Form. | C21H23ClFNO2 |
Mol. Mass. | 375.864 |
SMILES | OC1(CCN(CCCC(=O)c2ccc(F)cc2)CC1)c1ccc(Cl)cc1 |
Structure |
|