Reaction Details |
| Report a problem with these data |
Target | Histone H1.0 |
---|
Ligand | BDBM50130293 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | Binding Assay |
---|
Ki | 28±0.0 nM |
---|
Citation | Mates, S; Fienberg, A; Wennogle, L Methods and compositions for sleep disorders and other disorders US Patent US8598119 Publication Date 12/3/2013 |
---|
More Info.: | Get all data from this article, Assay Method |
---|
|
Histone H1.0 |
---|
Name: | Histone H1.0 |
Synonyms: | H1-0 | H10_HUMAN | H1F0 | H1FV | Histone H1 |
Type: | Cell-surface receptors |
Mol. Mass.: | 20917.09 |
Organism: | Homo sapiens (Human) |
Description: | P07305 |
Residue: | 194 |
Sequence: | MTENSTSAPAAKPKRAKASKKSTDHPKYSDMIVAAIQAEKNRAGSSRQSIQKYIKSHYKV
GENADSQIKLSIKRLVTTGVLKQTKGVGASGSFRLAKSDEPKKSVAFKKTKKEIKKVATP
KKASKPKKAASKAPTKKPKATPVKKAKKKLAATPKKAKKPKTVKAKPVKASKPKKAKPVK
PKAKSSAKRAGKKK
|
|
|
BDBM50130293 |
---|
n/a |
---|
Name | BDBM50130293 |
Synonyms: | 7-{4-[4-(2,3-dichlorophenyl)piperazin-1-yl]butoxy}-3,4-dihydroquinolin-2(1H)-one | ARIPIPRAZOLE | CHEMBL1112 | US10174011, aripiprazole | US10752588, Compound Aripiprazole | US11498896, Compound Aripiprazole | US9018213, aripprazole | US9156822, Aripiprazole |
Type | Small organic molecule |
Emp. Form. | C23H27Cl2N3O2 |
Mol. Mass. | 448.385 |
SMILES | Clc1cccc(N2CCN(CCCCOc3ccc4CCC(=O)Nc4c3)CC2)c1Cl |
Structure |
|