| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Histone H1.0 |
|---|
| Ligand | BDBM50095890 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | Binding Assay |
|---|
| Ki | 10±0.0 nM |
|---|
| Citation |  Mates, S; Fienberg, A; Wennogle, L Methods and compositions for sleep disorders and other disorders US Patent US8598119 Publication Date 12/3/2013 |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Histone H1.0 |
|---|
| Name: | Histone H1.0 |
|---|
| Synonyms: | H1-0 | H10_HUMAN | H1F0 | H1FV | Histone H1 |
|---|
| Type: | Cell-surface receptors |
|---|
| Mol. Mass.: | 20917.09 |
|---|
| Organism: | Homo sapiens (Human) |
|---|
| Description: | P07305 |
|---|
| Residue: | 194 |
|---|
| Sequence: | MTENSTSAPAAKPKRAKASKKSTDHPKYSDMIVAAIQAEKNRAGSSRQSIQKYIKSHYKV
GENADSQIKLSIKRLVTTGVLKQTKGVGASGSFRLAKSDEPKKSVAFKKTKKEIKKVATP
KKASKPKKAASKAPTKKPKATPVKKAKKKLAATPKKAKKPKTVKAKPVKASKPKKAKPVK
PKAKSSAKRAGKKK
|
|
|
|---|
| BDBM50095890 |
|---|
| n/a |
|---|
| Name | BDBM50095890 |
|---|
| Synonyms: | 2-[2-(4-Dibenzo[b,f][1,4]thiazepin-11-yl-1-piperazinyl)ethoxy]ethanol | 2-[2-(4-dibenzo[b,f][1,4]thiazepin-11-ylpiperazin-1-yl)ethoxy]ethanol | CHEMBL716 | QUETIAPINE |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C21H25N3O2S |
|---|
| Mol. Mass. | 383.507 |
|---|
| SMILES | OCCOCCN1CCN(CC1)C1=Nc2ccccc2Sc2ccccc12 |t:13| |
|---|
| Structure | 
|
|---|
Search and Browse
