Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetGlutaminase kidney isoform, mitochondrial
LigandBDBM108864
Substrate/Competitorn/a
Meas. Tech.Enzyme Assay-Time Dependence
IC50 3± 0 nM
Citation Li JChen LGoyal BLaidig GStanton TFSjogren EB Heterocyclic inhibitors of glutaminase US Patent  US8604016 Publication Date 12/10/2013
More Info.:Get all data from this article,  Assay Method
 
Glutaminase kidney isoform, mitochondrial
Name:Glutaminase kidney isoform, mitochondrial
Synonyms:GLS | GLS1 | Glutaminase 1 | K-glutaminase | KIAA0838 | L-glutamine amidohydrolase
Type:Protein
Mol. Mass.:73471.89
Organism:Homo sapiens (Human)
Description:O94925
Residue:669
Sequence:
MMRLRGSGMLRDLLLRSPAGVSATLRRAQPLVTLCRRPRGGGRPAAGPAAAARLHPWWGG
GGWPAEPLARGLSSSPSEILQELGKGSTHPQPGVSPPAAPAAPGPKDGPGETDAFGNSEG
KELVASGENKIKQGLLPSLEDLLFYTIAEGQEKIPVHKFITALKSTGLRTSDPRLKECMD
MLRLTLQTTSDGVMLDKDLFKKCVQSNIVLLTQAFRRKFVIPDFMSFTSHIDELYESAKK
QSGGKVADYIPQLAKFSPDLWGVSVCTVDGQRHSTGDTKVPFCLQSCVKPLKYAIAVNDL
GTEYVHRYVGKEPSGLRFNKLFLNEDDKPHNPMVNAGAIVVTSLIKQGVNNAEKFDYVMQ
FLNKMAGNEYVGFSNATFQSERESGDRNFAIGYYLKEKKCFPEGTDMVGILDFYFQLCSI
EVTCESASVMAATLANGGFCPITGERVLSPEAVRNTLSLMHSCGMYDFSGQFAFHVGLPA
KSGVAGGILLVVPNVMGMMCWSPPLDKMGNSVKGIHFCHDLVSLCNFHNYDNLRHFAKKL
DPRREGGDQRVKSVINLLFAAYTGDVSALRRFALSAMDMEQRDYDSRTALHVAAAEGHVE
VVKFLLEACKVNPFPKDRWNNTPMDEALHFGHHDVFKILQEYQVQYTPQGDSDNGKENQT
VHKNLDGLL
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM108864
n/a
NameBDBM108864
Synonyms:US8604016, 444
TypeSmall organic molecule
Emp. Form.C36H37N7O3S
Mol. Mass.647.789
SMILESCN(Cc1cccc(CC(=O)Nc2nnc(CCCCc3ccc(NC(=O)Cc4ccccc4)nn3)s2)c1)C(=O)Cc1ccccc1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: