Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetCalpain-2 (m-Calpain)
LigandBDBM110188
Substrate/Competitorn/a
Meas. Tech.m-Calpain Inhibition Assay
pH7.5±n/a
Temperature298.15±n/a K
IC50>1.00e+5± 0 nM
Commentsextracted
Citation Baek KHKarki RLee ESNa YKwon Y Synthesis and investigation of dihydroxychalcones as calpain and cathepsin inhibitors. Bioorg Chem 51:24-30 (2013) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Calpain-2 (m-Calpain)
Name:Calpain1/2
Synonyms:CANP 2 | Calcium-activated neutral proteinase 2 | Calpain 2 | Calpain M-type | Calpain large polypeptide L2 | Calpain-2 catalytic subunit | Calpain-2 large subunit | Calpain1/2 | M-calpain | Millimolar-calpain | calpain
Type:Protein
Mol. Mass.:79965.18
Organism:Homo sapiens (Human)
Description:n/a
Residue:700
Sequence:
MAGIAAKLAKDREAAEGLGSHDRAIKYLNQDYEALRNECLEAGTLFQDPSFPAIPSALGF
KELGPYSSKTRGIEWKRPTEICADPQFIIGGATRTDICQGALGDCWLLAAIASLTLNEEI
LARVVPLNQSFQENYAGIFHFQFWQYGEWVEVVVDDRLPTKDGELLFVHSAEGSEFWSAL
LEKAYAKINGCYEALSGGATTEGFEDFTGGIAEWYELKKPPPNLFKIIQKALQKGSLLGC
SIDITSAADSEAITFQKLVKGHAYSVTGAEEVESNGSLQKLIRIRNPWGEVEWTGRWNDN
CPSWNTIDPEERERLTRRHEDGEFWMSFSDFLRHYSRLEICNLTPDTLTSDTYKKWKLTK
MDGNWRRGSTAGGCRNYPNTFWMNPQYLIKLEEEDEDEEDGESGCTFLVGLIQKHRRRQR
KMGEDMHTIGFGIYEVPEELSGQTNIHLSKNFFLTNRARERSDTFINLREVLNRFKLPPG
EYILVPSTFEPNKDGDFCIRVFSEKKADYQAVDDEIEANLEEFDISEDDIDDGFRRLFAQ
LAGEDAEISAFELQTILRRVLAKRQDIKSDGFSIETCKIMVDMLDSDGSGKLGLKEFYIL
WTKIQKYQKIYREIDVDRSGTMNSYEMRKALEEAGFKMPCQLHQVIVARFADDQLIIDFD
NFVRCLVRLETLFKIFKQLDPENTGTIELDLISWLCFSVL
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM110188
n/a
NameBDBM110188
Synonyms:1-(2,4-Dihydroxyphenyl)-3-(pyridin-2-yl)propenone (8)
TypeSmall organic molecule
Emp. Form.C14H11NO3
Mol. Mass.241.242
SMILESOc1ccc(C(=O)\C=C\c2ccccn2)c(O)c1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: