Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetCannabinoid receptor 1
LigandBDBM113768
Substrate/Competitorn/a
Meas. Tech.CB1 & 2 Binding Assays
pH7.4±n/a
Temperature303.15±n/a K
Ki>1.0e+4± 0 nM
Commentsextracted
Citation Chicca ACaprioglio DMinassi APetrucci VAppendino GTaglialatela-Scafati OGertsch J Functionalization of -Caryophyllene Generates Novel Polypharmacology in the Endocannabinoid System. ACS Chem Biol 9:1499-507 (2014) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Cannabinoid receptor 1
Name:Cannabinoid receptor 1
Synonyms:CANN6 | CANNABINOID CB1 | CB-R | CB1 | CNR | CNR1 | Cannabinoid CB1 receptor | Cannabinoid receptor | Cannabinoid receptor 1 (CB1) | Cannabinoid receptor 1 (brain)
Type:G Protein-Coupled Receptor (GPCR)
Mol. Mass.:52868.96
Organism:Homo sapiens (Human)
Description:P21554
Residue:472
Sequence:
MKSILDGLADTTFRTITTDLLYVGSNDIQYEDIKGDMASKLGYFPQKFPLTSFRGSPFQE
KMTAGDNPQLVPADQVNITEFYNKSLSSFKENEENIQCGENFMDIECFMVLNPSQQLAIA
VLSLTLGTFTVLENLLVLCVILHSRSLRCRPSYHFIGSLAVADLLGSVIFVYSFIDFHVF
HRKDSRNVFLFKLGGVTASFTASVGSLFLTAIDRYISIHRPLAYKRIVTRPKAVVAFCLM
WTIAIVIAVLPLLGWNCEKLQSVCSDIFPHIDETYLMFWIGVTSVLLLFIVYAYMYILWK
AHSHAVRMIQRGTQKSIIIHTSEDGKVQVTRPDQARMDIRLAKTLVLILVVLIICWGPLL
AIMVYDVFGKMNKLIKTVFAFCSMLCLLNSTVNPIIYALRSKDLRHAFRSMFPSCEGTAQ
PLDNSMGDSDCLHKHANNAASVHRAAESCIKSTVKIAKVTMSVSTDTSAEAL
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM113768
n/a
NameBDBM113768
Synonyms:(E)-N-(3,4-Dihydroxyphenethyl)-6-((1R,2R)-3,3-dimethyl-2-(3-methylbut-3-enyl)cyclobutyl)hepta-2,6-dienamide (11f)
TypeSmall organic molecule
Emp. Form.C26H37NO3
Mol. Mass.411.5769
SMILESCC(=C)CC[C@@H]1[C@@H](CC1(C)C)C(=C)CC\C=C\C(=O)NCCc1ccc(O)c(O)c1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: