| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Major prion protein |
|---|
| Ligand | BDBM47311 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | TRFRET-based cell-based high throughput dose response assay to identify inhibitors of cell surface Prion Protein (PRPC) |
|---|
| IC50 | 1048±n/a nM |
|---|
| Citation |  PubChem, PC TRFRET-based cell-based high throughput dose response assay to identify inhibitors of cell surface Prion Protein (PRPC) PubChem Bioassay(2014)[AID] |
|---|
| More Info.: | Get all data from this article, Solution Info, Assay Method |
|---|
| |
| Major prion protein |
|---|
| Name: | Major prion protein |
|---|
| Synonyms: | ALTPRP | ASCR | CD_antigen=CD230 | PRIO_HUMAN | PRIP | PRNP | PRP | PrP27-30 | PrP33-35C | Prion protein | major prion protein preproprotein |
|---|
| Type: | PROTEIN |
|---|
| Mol. Mass.: | 27671.97 |
|---|
| Organism: | Homo sapiens (Human) |
|---|
| Description: | ChEMBL_158887 |
|---|
| Residue: | 253 |
|---|
| Sequence: | MANLGCWMLVLFVATWSDLGLCKKRPKPGGWNTGGSRYPGQGSPGGNRYPPQGGGGWGQP
HGGGWGQPHGGGWGQPHGGGWGQPHGGGWGQGGGTHSQWNKPSKPKTNMKHMAGAAAAGA
VVGGLGGYMLGSAMSRPIIHFGSDYEDRYYRENMHRYPNQVYYRPMDEYSNQNNFVHDCV
NITIKQHTVTTTTKGENFTETDVKMMERVVEQMCITQYERESQAYYQRGSSMVLFSSPPV
ILLISFLIFLIVG
|
|
|
|---|
| BDBM47311 |
|---|
| n/a |
|---|
| Name | BDBM47311 |
|---|
| Synonyms: | 2-[(4-chlorobenzyl)sulfanyl]-6-oxo-4-(2-thienyl)-1,6-dihydro-5-pyrimidinecarbonitrile | 2-[(4-chlorobenzyl)thio]-4-keto-6-(2-thienyl)-1H-pyrimidine-5-carbonitrile | 2-[(4-chlorophenyl)methylsulfanyl]-4-oxidanylidene-6-thiophen-2-yl-1H-pyrimidine-5-carbonitrile | 2-[(4-chlorophenyl)methylsulfanyl]-4-oxo-6-thiophen-2-yl-1H-pyrimidine-5-carbonitrile | 2-[(4-chlorophenyl)methylthio]-4-oxo-6-thiophen-2-yl-1H-pyrimidine-5-carbonitrile | MLS000705749 | SMR000231786 | cid_1234393 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C16H10ClN3OS2 |
|---|
| Mol. Mass. | 359.853 |
|---|
| SMILES | Clc1ccc(CSc2nc(-c3cccs3)c(C#N)c(=O)[nH]2)cc1 |
|---|
| Structure | 
|
|---|
Search and Browse
