Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetAmine oxidase [flavin-containing] A
LigandBDBM113742
Substrate/Competitorn/a
Meas. Tech.MAO-A/B Activity and Inhibition Assay
pH7.5±n/a
Ki 2.6e+3± 2.3e+3 nM
Commentsextracted
Citation Prusevich PKalin JHMing SABasso MGivens JLi XHu JTaylor MSCieniewicz AMHsiao PYHuang RRoberson HAdejola NAvery LBCasero RATaverna SDQian JTackett AJRatan RRMcDonald OGFeinberg APCole PA A Selective Phenelzine Analogue Inhibitor of Histone Demethylase LSD1. ACS Chem Biol 9:1284-93 (2014) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Amine oxidase [flavin-containing] A
Name:Amine oxidase [flavin-containing] A
Synonyms:Amine oxidase (flavin-containing) A | MAO-A | Monoamine oxidase | Monoamine oxidase type A | Monoamine oxidase type A (MAO A) | Monoamine oxidase type A (MAO A) | Monoamine oxidase type A (MAOA)
Type:Protein
Mol. Mass.:59689.53
Organism:Homo sapiens (Human)
Description:P21397
Residue:527
Sequence:
MENQEKASIAGHMFDVVVIGGGISGLSAAKLLTEYGVSVLVLEARDRVGGRTYTIRNEHV
DYVDVGGAYVGPTQNRILRLSKELGIETYKVNVSERLVQYVKGKTYPFRGAFPPVWNPIA
YLDYNNLWRTIDNMGKEIPTDAPWEAQHADKWDKMTMKELIDKICWTKTARRFAYLFVNI
NVTSEPHEVSALWFLWYVKQCGGTTRIFSVTNGGQERKFVGGSGQVSERIMDLLGDQVKL
NHPVTHVDQSSDNIIIETLNHEHYECKYVINAIPPTLTAKIHFRPELPAERNQLIQRLPM
GAVIKCMMYYKEAFWKKKDYCGCMIIEDEDAPISITLDDTKPDGSLPAIMGFILARKADR
LAKLHKEIRKKKICELYAKVLGSQEALHPVHYEEKNWCEEQYSGGCYTAYFPPGIMTQYG
RVIRQPVGRIFFAGTETATKWSGYMEGAVEAGERAAREVLNGLGKVTEKDIWVQEPESKD
VPAVEITHTFWERNLPSVSGLLKIIGFSTSVTALGFVLYKYKLLPRS
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM113742
n/a
NameBDBM113742
Synonyms:N-[4-(2-Hydrazinylethyl)phenyl]-4-phenylbutanamide dihydrochloride salt (12d)
TypeSmall organic molecule
Emp. Form.C18H23N3O
Mol. Mass.297.3947
SMILESNNCCc1ccc(NC(=O)CCCc2ccccc2)cc1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: