Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetMurE (E. coli)
LigandBDBM119122
Substrate/Competitorn/a
IC50 1.6e+4± 0 nM
Citation Hrast MSosic ISink RGobec S Inhibitors of the peptidoglycan biosynthesis enzymes MurA-F. Bioorg Chem 55:2-15 (2014) [PubMed]  Article
More Info.:Get all data from this article
 
MurE (E. coli)
Name:MurE (E. coli)
Synonyms:UDP-N-acetylmuramoyl-L-alanyl-D-glutamate--2,6-diaminopimelate ligase
Type:Protein
Mol. Mass.:53321.37
Organism:Escherichia coli UMNK88 (Enterobacteria)
Description:A0A0E0TTA0
Residue:495
Sequence:
MADRNLRDLLAPWVPDAPSRALREMTLDSRVAAAGDLFVAVVGHQADGRRYIPQAIAQGV
AAIIAEAKDEATDGEIREMHGVPVIYLSQLNERLSALAGRFYHEPSDNLRLVGVTGTNGK
TTTTQLLAQWSQLLGETSAVMGTVGNGLLGKVIPTENTTGSAVDVQHELAGLVDQGATFC
AMEVSSHGLVQHRVAALKFAASVFTNLSRDHLDYHGDMEHYEAAKWLLYSEHHCGQAIIN
ADDEVGRRWLAKLPDAVAVSMEDHINPNCHGRWLKATEVNYHDSGATIRFSSSWGDGEIE
SHLMGAFNVSNLLLALATLLALGYPLADLLKTAARLQPVCGRMEVFTAPGKPTVVVDYAH
TPDALEKALQAARLHCAGKLWCVFGCGGDRDKGKRPLMGAIAEEFADVAVVTDDNPRTEE
PRAIINDILAGMLDAGHAKVMEGRAEAVTCAVMQAKENDVVLVAGKGHEDYQIVGNQRLD
YSDRVTVARLLGVIA
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM119122
n/a
NameBDBM119122
Synonyms:MurA/B/C/D/E inhibitor (compound 67)
TypeSmall organic molecule
Emp. Form.C22H13F3O3
Mol. Mass.382.332
SMILESFC(F)(F)c1ccc(cc1)C1C(=O)OC(=Cc2cccc3ccccc23)C1=O |w:15.16|
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: