| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Arachidonate 5-lipoxygenase-activating protein |
|---|
| Ligand | BDBM283262 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | Binding Assay |
|---|
| Ki | <0.1±n/a nM |
|---|
| Citation |  Bacani, GM; Eccles, W; Fitzgerald, AE; Goldberg, SD; Hack, MD; Hawryluk, NA; Jones, WM; Keith, JM; Krawczuk, P; Lebsack, AD; Lee-Dutra, A; Liu, J; McClure, KJ; Meduna, SP; Pippel, DJ; Rosen, MD; Sales, ZS FLAP modulators US Patent US9884878 Publication Date 2/6/2018 |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Arachidonate 5-lipoxygenase-activating protein |
|---|
| Name: | Arachidonate 5-lipoxygenase-activating protein |
|---|
| Synonyms: | 5-lipoxygenase activating protein | 5-lipoxygenase-activating protein (FLAP) | 5-lipoxygenase/FLAP | AL5AP_HUMAN | ALOX5AP | FLAP | MK-886-binding protein |
|---|
| Type: | Enzyme |
|---|
| Mol. Mass.: | 18159.90 |
|---|
| Organism: | Homo sapiens (Human) |
|---|
| Description: | P20292 |
|---|
| Residue: | 161 |
|---|
| Sequence: | MDQETVGNVVLLAIVTLISVVQNGFFAHKVEHESRTQNGRSFQRTGTLAFERVYTANQNC
VDAYPTFLAVLWSAGLLCSQVPAAFAGLMYLFVRQKYFVGYLGERTQSTPGYIFGKRIIL
FLFLMSVAGIFNYYLIFFFGSDFENYIKTISTTISPLLLIP
|
|
|
|---|
| BDBM283262 |
|---|
| n/a |
|---|
| Name | BDBM283262 |
|---|
| Synonyms: | (S)-(1-{[4'-(5-Aminopyrazin-2-yl)-3'- fluorobiphenyl-2-yl]sulfonyl}-2,3-dihydro-1H- indol-2-yl)methanol | US9745328, Compound 135 | US9884878, Compound 135 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C25H21FN4O3S |
|---|
| Mol. Mass. | 476.523 |
|---|
| SMILES | Nc1cnc(cn1)-c1ccc(cc1F)-c1ccccc1S(=O)(=O)N1[C@H](CO)Cc2ccccc12 |r| |
|---|
| Structure | 
|
|---|
Search and Browse
