Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetEnoyl-acyl carrier reductase
LigandBDBM50435717
Substrate/Competitorn/a
Meas. Tech.TgENR Inhibition Assay
pH7.5±n/a
IC50 19±0.0 nM
Commentsextracted
Citation Afanador GAMuench SPMcPhillie MFomovska ASchön ASchön YCheng GStec JFreundlich JSShieh HMAnderson JWJacobus DPFidock DAKozikowski APFishwick CWRice DWFreire EMcLeod RPrigge ST Discrimination of potent inhibitors of Toxoplasma gondii enoyl-acyl carrier protein reductase by a thermal shift assay. Biochemistry 52:9155-66 (2013) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Enoyl-acyl carrier reductase
Name:Enoyl-acyl carrier reductase
Synonyms:Enoyl-acyl carrier reductase (ENR) | Enoyl-acyl carrier reductase, putative
Type:PROTEIN
Mol. Mass.:43663.67
Organism:Toxoplasma gondii
Description:ChEMBL_1290812
Residue:417
Sequence:
MVGFKLLTLGAFVAGELTLVGPAGTMAFTVPNATGAKPLVTSVSVRPSWSSARQNAFSSS
SSRSQSSVRPHSAFVTNRLETAGETGTQHRAADSAAGVGAAQSAFPIDLRGQTAFVAGVA
DSHGYGWAIAKHLASAGARVALGTWPPVLGLFQKSLQSGRLDEDRKLPDGSLIEFAGVYP
LDAAFDKPEDVPQDIKDNKRYAGVDGYTIKEVAVKVKQDLGNIDILVHSLANGPEVTKPL
LETSRKGYLAASSNSAYSFVSLLQHFGPIMNEGGSAVTLSYLAAERVVPGYGGGMSSAKA
ALESDTRTLAWEAGQKYGVRVNAISAGPLKSRAASAIGKSGEKSFIDYAIDYSYNNAPLR
RDLHSDDVGGAALFLLSPLARAVSGVTLYVDNGLHAMGQAVDSRSMPPLQRATQEIN
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50435717
n/a
NameBDBM50435717
Synonyms:CHEMBL2392450 | N‐{[4‐(2,4‐dichlorophenoxy)‐3‐ hydroxyphenyl]methyl}‐5‐methyl‐1,2‐oxazole‐3‐ carboxamide (27)
TypeSmall organic molecule
Emp. Form.C18H14Cl2N2O4
Mol. Mass.393.221
SMILESCc1cc(no1)C(=O)NCc1ccc(Oc2ccc(Cl)cc2Cl)c(O)c1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: