Reaction Details |
| Report a problem with these data |
Target | Fatty acid-binding protein, liver |
---|
Ligand | BDBM119875 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | ANS Fluorescence Displacement Assay |
---|
Ki | 35± 3 nM |
---|
Citation | Martin, GG; McIntosh, AL; Huang, H; Gupta, S; Atshaves, BP; Landrock, KK; Landrock, D; Kier, AB; Schroeder, F The human liver fatty acid binding protein T94A variant alters the structure, stability, and interaction with fibrates. Biochemistry52:9347-57 (2013) [PubMed] Article |
---|
More Info.: | Get all data from this article, Assay Method |
---|
|
Fatty acid-binding protein, liver |
---|
Name: | Fatty acid-binding protein, liver |
Synonyms: | FABP1 | FABPL | FABPL_HUMAN | Fatty acid-binding protein, liver | Liver fatty acid binding protein (human L-FABP T94T) |
Type: | Protein |
Mol. Mass.: | 14208.72 |
Organism: | Homo sapiens (Human) |
Description: | human L-FABP |
Residue: | 127 |
Sequence: | MSFSGKYQLQSQENFEAFMKAIGLPEELIQKGKDIKGVSEIVQNGKHFKFTITAGSKVIQ
NEFTVGEECELETMTGEKVKTVVQLEGDNKLVTTFKNIKSVTELNGDIITNTMTLGDIVF
KRISKRI
|
|
|
BDBM119875 |
---|
n/a |
---|
Name | BDBM119875 |
Synonyms: | 3,7,11,15-tetramethylhexadecanoic acid | Phytanic acid |
Type | Small organic molecule |
Emp. Form. | C20H40O2 |
Mol. Mass. | 312.5304 |
SMILES | CC(C)CCCC(C)CCCC(C)CCCC(C)CC(O)=O |
Structure |
|