Reaction Details |
| Report a problem with these data |
Target | Fatty acid-binding protein, liver |
---|
Ligand | BDBM119875 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | ANS Fluorescence Displacement Assay |
---|
Ki | 37± 2 nM |
---|
Citation | Martin, GG; McIntosh, AL; Huang, H; Gupta, S; Atshaves, BP; Landrock, KK; Landrock, D; Kier, AB; Schroeder, F The human liver fatty acid binding protein T94A variant alters the structure, stability, and interaction with fibrates. Biochemistry52:9347-57 (2013) [PubMed] Article |
---|
More Info.: | Get all data from this article, Assay Method |
---|
|
Fatty acid-binding protein, liver |
---|
Name: | Fatty acid-binding protein, liver |
Synonyms: | FABPL_RAT | Fabp1 | Fatty acid-binding protein, liver | Liver fatty acid binding protein (rat L-FABP) |
Type: | Protein |
Mol. Mass.: | 14274.39 |
Organism: | Rattus norvegicus (Rat) |
Description: | rat L-FABP |
Residue: | 127 |
Sequence: | MNFSGKYQVQSQENFEPFMKAMGLPEDLIQKGKDIKGVSEIVHEGKKVKLTITYGSKVIH
NEFTLGEECELETMTGEKVKAVVKMEGDNKMVTTFKGIKSVTEFNGDTITNTMTLGDIVY
KRVSKRI
|
|
|
BDBM119875 |
---|
n/a |
---|
Name | BDBM119875 |
Synonyms: | 3,7,11,15-tetramethylhexadecanoic acid | Phytanic acid |
Type | Small organic molecule |
Emp. Form. | C20H40O2 |
Mol. Mass. | 312.5304 |
SMILES | CC(C)CCCC(C)CCCC(C)CCCC(C)CC(O)=O |
Structure |
|