Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetMitogen-activated protein kinase 1
LigandBDBM120086
Substrate/Competitorn/a
Meas. Tech.Enzymatic Assay
pH7.3±n/a
IC50 3.9±n/a nM
Commentsextracted
Citation Blake JFChicarelli MJGarrey RFGaudino JGrina JMoreno DAMohr PJRen LSchwarz JChen HRobarge KZhou A Serine/threonine kinase inhibitors US Patent  US8697715 Publication Date 4/15/2014
More Info.:Get all data from this article,  Assay Method
 
Mitogen-activated protein kinase 1
Name:Mitogen-activated protein kinase 1
Synonyms:ERK2 | ERT1 | Extracellular signal-regulated kinase 2 | Extracellular signal-regulated kinase 2 (ERK-2) | Extracellular signal-regulated kinase 2 (ERK2) | MAP Kinase 2/ERK2 | MAPK 2 | MAPK1 | Mitogen activated kinase 1 (ERK-2) | Mitogen-activated protein kinase 1 (ERK-2) | Mitogen-activated protein kinase 1 (ERK2) | Mitogen-activated protein kinase 2 | p42-MAPK
Type:Ser/Thr Protein Kinase
Mol. Mass.:41392.76
Organism:Homo sapiens (Human)
Description:P28482
Residue:360
Sequence:
MAAAAAAGAGPEMVRGQVFDVGPRYTNLSYIGEGAYGMVCSAYDNVNKVRVAIKKISPFE
HQTYCQRTLREIKILLRFRHENIIGINDIIRAPTIEQMKDVYIVQDLMETDLYKLLKTQH
LSNDHICYFLYQILRGLKYIHSANVLHRDLKPSNLLLNTTCDLKICDFGLARVADPDHDH
TGFLTEYVATRWYRAPEIMLNSKGYTKSIDIWSVGCILAEMLSNRPIFPGKHYLDQLNHI
LGILGSPSQEDLNCIINLKARNYLLSLPHKNKVPWNRLFPNADSKALDLLDKMLTFNPHK
RIEVEQALAHPYLEQYYDPSDEPIAEAPFKFDMELDDLPKEKLKELIFEETARFQPGYRS
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM120086
n/a
NameBDBM120086
Synonyms:US8697715, 1 | US9259470, 1
TypeSmall organic molecule
Emp. Form.C22H22ClFN4O3
Mol. Mass.444.886
SMILESOC[C@H](c1ccc(Cl)c(F)c1)n1ccc(cc1=O)-c1ccnc(NC2CCOCC2)n1 |r|
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: