Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetCathepsin B
LigandBDBM120823
Substrate/Competitorn/a
Meas. Tech.Enzymatic activity assay
pH6±n/a
Temperature310.15±n/a K
Ki 0.211±0.020 nM
Commentsextracted
Citation Raghav NGarg S N-formylpyrazolines and N-benzoylpyrazolines as novel inhibitors of mammalian cathepsin B and cathepsin H. Bioorg Chem 57:43-50 (2014) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Cathepsin B
Name:Cathepsin B
Synonyms:n/a
Type:Protein
Mol. Mass.:36777.57
Organism:Capra hircus (Goat)
Description:n/a
Residue:335
Sequence:
MWQLLATLSCLLVLTSARSSLHFPPLSDEMVNYVNKQNTTWKAGHNFYNVDLSYVKKLCG
AILGGPKLPQRDAFAADMVLPDSFDAREQWPNCPTIKEIRDQGSCGSCWAFGAVEAISDR
ICIHSKGRVNVEVSAEDMLTCCGSECGDGCNGGFPSGAWNFWTKKGLVSGGLYDSHVGCR
PYSIPPCEHHVNGSRPPCTGEGDTPKCSKICEPGYSPSYKDDKHFGCSSYSVSSNEKEIM
AEIYKNGPVEGAFSVYSDFLLYKSGVYQHVSGEMMGGHAIRILGWGVENDTPYWLVGNSW
NTDWGDKGFFKILRGQDHCGIESEIVAGMPCTHQY
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM120823
n/a
NameBDBM120823
Synonyms:N-formyl-5-(-4'-chlorophenyl)-3-phenylpyrazoline (1d)
TypeSmall organic molecule
Emp. Form.C16H13ClN2O
Mol. Mass.284.74
SMILESClc1ccc(cc1)C1CC(=NN1C=O)c1ccccc1 |c:10|
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: