Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetHistone deacetylase 8
LigandBDBM120953
Substrate/Competitorn/a
Meas. Tech.Fluorometric Assay
IC50 2130±n/a nM
Citation Guo LTang GWang ZWong JCZhang W N-hydroxy-benzamids for the treatment of cancer US Patent  US8716285 Publication Date 5/6/2014
More Info.:Get all data from this article,  Assay Method
 
Histone deacetylase 8
Name:Histone deacetylase 8
Synonyms:HD8 | Histone deacetylase 8 (HDAC-8) | Human HDAC8
Type:Enzyme
Mol. Mass.:41749.60
Organism:Homo sapiens (Human)
Description:Q9BY41
Residue:377
Sequence:
MEEPEEPADSGQSLVPVYIYSPEYVSMCDSLAKIPKRASMVHSLIEAYALHKQMRIVKPK
VASMEEMATFHTDAYLQHLQKVSQEGDDDHPDSIEYGLGYDCPATEGIFDYAAAIGGATI
TAAQCLIDGMCKVAINWSGGWHHAKKDEASGFCYLNDAVLGILRLRRKFERILYVDLDLH
HGDGVEDAFSFTSKVMTVSLHKFSPGFFPGTGDVSDVGLGKGRYYSVNVPIQDGIQDEKY
YQICESVLKEVYQAFNPKAVVLQLGADTIAGDPMCSFNMTPVGIGKCLKYILQWQLATLI
LGGGGYNLANTARCWTYLTGVILGKTLSSEIPDHEFFTAYGPDYVLEITPSCRPDRNEPH
RIQQILNYIKGNLKHVV
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM120953
n/a
NameBDBM120953
Synonyms:US8716285, 10
TypeSmall organic molecule
Emp. Form.C21H20N4O2
Mol. Mass.360.4091
SMILESONC(=O)c1ccc2CCC(Cc2c1)Nc1nccc(n1)-c1ccccc1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: