Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetCore-binding factor subunit beta (CBFB)
LigandBDBM123665
Substrate/Competitorn/a
Meas. Tech.FRET Assay
IC50 1000±n/a nM
Citation Bushweller JHGrembecka JIllendula ADixon L Inhibitors of inv(16) leukemia US Patent  US8748618 Publication Date 6/10/2014
More Info.:Get all data from this article,  Assay Method
 
Core-binding factor subunit beta (CBFB)
Name:Core-binding factor subunit beta (CBFB)
Synonyms:n/a
Type:Enzyme
Mol. Mass.:21507.90
Organism:Homo sapiens (Human)
Description:Q13951
Residue:182
Sequence:
MPRVVPDQRSKFENEEFFRKLSRECEIKYTGFRDRPHEERQARFQNACRDGRSEIAFVAT
GTNLSLQFFPASWQGEQRQTPSREYVDLEREAGKVYLKAPMILNGVCVIWKGWIDLQRLD
GMGCLEFDEERAQQEDALAQQAFEEARRRTREFEDRDRSHREEMEVRVSQLLAVTGKKTT
RP
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM123665
n/a
NameBDBM123665
Synonyms:US8748618, AI-10-47
TypeSmall organic molecule
Emp. Form.C13H8F3N3O
Mol. Mass.279.2173
SMILESFC(F)(F)Oc1ccc2nc([nH]c2c1)-c1ccccn1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: