| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Core-binding factor subunit beta |
|---|
| Ligand | BDBM123671 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | FRET Assay |
|---|
| IC50 | 1300±n/a nM |
|---|
| Citation |  Bushweller, JH; Grembecka, J; Illendula, A; Dixon, L Inhibitors of inv(16) leukemia US Patent US8748618 Publication Date 6/10/2014 |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Core-binding factor subunit beta |
|---|
| Name: | Core-binding factor subunit beta |
|---|
| Synonyms: | CBFB | Core-binding factor subunit beta (CBFB) | PEBB_HUMAN |
|---|
| Type: | Enzyme |
|---|
| Mol. Mass.: | 21507.90 |
|---|
| Organism: | Homo sapiens (Human) |
|---|
| Description: | Q13951 |
|---|
| Residue: | 182 |
|---|
| Sequence: | MPRVVPDQRSKFENEEFFRKLSRECEIKYTGFRDRPHEERQARFQNACRDGRSEIAFVAT
GTNLSLQFFPASWQGEQRQTPSREYVDLEREAGKVYLKAPMILNGVCVIWKGWIDLQRLD
GMGCLEFDEERAQQEDALAQQAFEEARRRTREFEDRDRSHREEMEVRVSQLLAVTGKKTT
RP
|
|
|
|---|
| BDBM123671 |
|---|
| n/a |
|---|
| Name | BDBM123671 |
|---|
| Synonyms: | US8748618, AI-10-51 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C13H10ClN3O |
|---|
| Mol. Mass. | 259.691 |
|---|
| SMILES | OCc1cc2nc([nH]c2cc1Cl)-c1ccccn1 |
|---|
| Structure | 
|
|---|
Search and Browse
