Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetG protein-coupled receptor 44
LigandBDBM124825
Substrate/Competitorn/a
Meas. Tech.Radioligand Binding Assay
pH7.4±n/a
Temperature298.15±n/a K
Ki 0.2±n/a nM
Commentsextracted
Citation Anderskewitz RMartyres DOost TRist WSeither P Pyrazole compounds as CRTH2 antagonists US Patent  US8759386 Publication Date 6/24/2014
More Info.:Get all data from this article,  Assay Method
 
G protein-coupled receptor 44
Name:G protein-coupled receptor 44
Synonyms:CD_antigen=CD294 | Chemoattractant Receptor-homologous molecule expressed on T-helper type 2 cells (CRTH2) | Chemoattractant receptor-homologous molecule expressed on Th2 cells | Chemoattractant receptor-homologous molecule expressed on Th2 cells (CRTH2) | G-protein coupled receptor 44 | Prostaglandin D2 | Prostaglandin D2 receptor 2 | Prostaglandin D2 receptor 2 (PGD2)
Type:Enzyme
Mol. Mass.:43295.45
Organism:Homo sapiens (Human)
Description:Q9Y5Y4
Residue:395
Sequence:
MSANATLKPLCPILEQMSRLQSHSNTSIRYIDHAAVLLHGLASLLGLVENGVILFVVGCR
MRQTVVTTWVLHLALSDLLASASLPFFTYFLAVGHSWELGTTFCKLHSSIFFLNMFASGF
LLSAISLDRCLQVVRPVWAQNHRTVAAAHKVCLVLWALAVLNTVPYFVFRDTISRLDGRI
MCYYNVLLLNPGPDRDATCNSRQVALAVSKFLLAFLVPLAIIASSHAAVSLRLQHRGRRR
PGRFVRLVAAVVAAFALCWGPYHVFSLLEARAHANPGLRPLVWRGLPFVTSLAFFNSVAN
PVLYVLTCPDMLRKLRRSLRTVLESVLVDDSELGGAGSSRRRRTSSTARSASPLALCSRP
EEPRGPARLLGWLLGSCAASPQTGPLNRALSSTSS
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM124825
n/a
NameBDBM124825
Synonyms:US8759386, 22
TypeSmall organic molecule
Emp. Form.C27H30N4O3
Mol. Mass.458.5521
SMILESCCc1nn(Cc2ccc(NC(=O)c3cc4ccccc4n3CC)cc2)c(CC)c1CC(O)=O
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: