Reaction Details |
| Report a problem with these data |
Target | Dimer of Gag-Pol polyprotein [489-587,M535I,L552P,A560V,V571F,I573V] |
---|
Ligand | BDBM4688 |
---|
Substrate/Competitor | BDBM4685 |
---|
Meas. Tech. | Fluorometric Activity Assay |
---|
pH | 5.5±n/a |
---|
Temperature | 303.15±n/a K |
---|
Ki | 0.0043±n/a nM |
---|
Comments | Ki=r*KiGW0385, r is determined at equilibrium from measured [E[3H]GW0385] and total concentrations of E, [3H]GW0385, and compound. |
---|
Citation | Hanlon, MH; Porter, DJ; Furfine, ES; Spaltenstein, A; Carter, HL; Danger, D; Shu, AY; Kaldor, IW; Miller, JF; Samano, VA Inhibition of wild-type and mutant human immunodeficiency virus type 1 proteases by GW0385 and other arylsulfonamides. Biochemistry43:14500-7 (2004) [PubMed] Article |
---|
More Info.: | Get all data from this article, Solution Info, Assay Method |
---|
|
Dimer of Gag-Pol polyprotein [489-587,M535I,L552P,A560V,V571F,I573V] |
---|
Name: | Dimer of Gag-Pol polyprotein [489-587,M535I,L552P,A560V,V571F,I573V] |
Synonyms: | HIV-1 Protease Mutant (M46I,L63P,A71V,V82F,I84V) |
Type: | Protein Complex |
Mol. Mass.: | n/a |
Description: | n/a |
Components: | This complex has 2 components. |
Component 1 |
Name: | Gag-Pol polyprotein [489-587,M535I,L552P,A560V,V571F,I573V] |
Synonyms: | HIV-1 Protease Mutant (M46I,L63P,A71V,V82F,I84V) | HIV-1 Protease Mutant (M46I,L63P,A71V,V82F,I84V) Chain A | HIV-1 Protease Mutant (M46I,L63P,A71V,V82F,I84V) Chain B | POL_HV1H2 | gag-pol |
Type: | Enzyme Subunit |
Mol. Mass.: | 10809.15 |
Organism: | Human immunodeficiency virus type 1 |
Description: | P04585[489-587,M535I,L552P,A560V,V571F,I573V] |
Residue: | 99 |
Sequence: | PQVTLWQRPLVTIKIGGQLKEALLDTGADDTVLEEMSLPGRWKPKIIGGIGGFIKVRQYD
QIPIEICGHKVIGTVLVGPTPFNVIGRNLLTQIGCTLNF
|
|
|
Component 2 |
Name: | Gag-Pol polyprotein [489-587,M535I,L552P,A560V,V571F,I573V] |
Synonyms: | HIV-1 Protease Mutant (M46I,L63P,A71V,V82F,I84V) | HIV-1 Protease Mutant (M46I,L63P,A71V,V82F,I84V) Chain A | HIV-1 Protease Mutant (M46I,L63P,A71V,V82F,I84V) Chain B | POL_HV1H2 | gag-pol |
Type: | Enzyme Subunit |
Mol. Mass.: | 10809.15 |
Organism: | Human immunodeficiency virus type 1 |
Description: | P04585[489-587,M535I,L552P,A560V,V571F,I573V] |
Residue: | 99 |
Sequence: | PQVTLWQRPLVTIKIGGQLKEALLDTGADDTVLEEMSLPGRWKPKIIGGIGGFIKVRQYD
QIPIEICGHKVIGTVLVGPTPFNVIGRNLLTQIGCTLNF
|
|
|
BDBM4688 |
---|
BDBM4685 |
---|
Name | BDBM4688 |
Synonyms: | (3R,3aS,6aR)-hexahydrofuro[2,3-b]furan-3-yl N-[(2S,3R)-4-[2H-1,3-benzodioxole-5-({6-[(ethoxycarbonyl)amino]-2,2-dimethylhexyl})sulfonamido]-3-hydroxy-1-phenylbutan-2-yl]carbamate | GW0385 analog 3 |
Type | Small organic molecule |
Emp. Form. | C35H49N3O11S |
Mol. Mass. | 719.842 |
SMILES | [H][C@@]12CCO[C@]1([H])OC[C@@H]2OC(=O)N[C@@H](Cc1ccccc1)[C@H](O)CN(CC(C)(C)CCCCNC(=O)OCC)S(=O)(=O)c1ccc2OCOc2c1 |r| |
Structure |
|