| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Dimer of Gag-Pol polyprotein [489-587,L499I,L508Q,K509R,E524D,M525I,S526N,M535I,I539V,I543V,I551V,L552P,A560V,V571A,L579M] |
|---|
| Ligand | BDBM4690 |
|---|
| Substrate/Competitor | BDBM4685 |
|---|
| Meas. Tech. | Fluorometric Activity Assay |
|---|
| pH | 5.5±n/a |
|---|
| Temperature | 303.15±n/a K |
|---|
| Ki | 0.0017±n/a nM |
|---|
| Comments | Ki=r*KiGW0385, r is determined at equilibrium from measured [E[3H]GW0385] and total concentrations of E, [3H]GW0385, and compound. |
|---|
| Citation |  Hanlon, MH; Porter, DJ; Furfine, ES; Spaltenstein, A; Carter, HL; Danger, D; Shu, AY; Kaldor, IW; Miller, JF; Samano, VA Inhibition of wild-type and mutant human immunodeficiency virus type 1 proteases by GW0385 and other arylsulfonamides. Biochemistry43:14500-7 (2004) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Solution Info, Assay Method |
|---|
| |
| Dimer of Gag-Pol polyprotein [489-587,L499I,L508Q,K509R,E524D,M525I,S526N,M535I,I539V,I543V,I551V,L552P,A560V,V571A,L579M] |
|---|
| Name: | Dimer of Gag-Pol polyprotein [489-587,L499I,L508Q,K509R,E524D,M525I,S526N,M535I,I539V,I543V,I551V,L552P,A560V,V571A,L579M] |
|---|
| Synonyms: | HIV-1 Protease Mutant (L10I,L19Q,K20R,E35D,M36I, ..) |
|---|
| Type: | Protein Complex |
|---|
| Mol. Mass.: | n/a |
|---|
| Description: | n/a |
|---|
| Components: | This complex has 2 components. |
|---|
| Component 1 |
| Name: | Gag-Pol polyprotein [489-587,L499I,L508Q,K509R,E524D,M525I,S526N,M535I,I539V,I543V,I551V,L552P,A560V,V571A,L579M] |
|---|
| Synonyms: | HIV-1 Protease Mutant (L10I,L19Q,K20R,E35D,M36I, ..) Chain A | HIV-1 Protease Mutant (L10I,L19Q,K20R,E35D,M36I, ..) Chain B | HIV-1 Protease Mutant (L10I,L19Q,K20R,E35D,M36I,S37N,M46I,I50V,I54V,I62V, L63P,A71V,V82A,L90M) | POL_HV1H2 | gag-pol |
|---|
| Type: | Enzyme Subunit |
|---|
| Mol. Mass.: | 10760.98 |
|---|
| Organism: | Human immunodeficiency virus type 1 |
|---|
| Description: | P04585[489-587,L499I,L508Q,K509R,E524D,M525I,S526N,M535I,I539V,I543V,I551V,L552P,A560V,V571A,L579M] |
|---|
| Residue: | 99 |
|---|
| Sequence: | PQVTLWQRPIVTIKIGGQQREALLDTGADDTVLEDINLPGRWKPKIIGGVGGFVKVRQYD
QVPIEICGHKVIGTVLVGPTPANIIGRNLMTQIGCTLNF
|
|
|
|---|
| Component 2 |
| Name: | Gag-Pol polyprotein [489-587,L499I,L508Q,K509R,E524D,M525I,S526N,M535I,I539V,I543V,I551V,L552P,A560V,V571A,L579M] |
|---|
| Synonyms: | HIV-1 Protease Mutant (L10I,L19Q,K20R,E35D,M36I, ..) Chain A | HIV-1 Protease Mutant (L10I,L19Q,K20R,E35D,M36I, ..) Chain B | HIV-1 Protease Mutant (L10I,L19Q,K20R,E35D,M36I,S37N,M46I,I50V,I54V,I62V, L63P,A71V,V82A,L90M) | POL_HV1H2 | gag-pol |
|---|
| Type: | Enzyme Subunit |
|---|
| Mol. Mass.: | 10760.98 |
|---|
| Organism: | Human immunodeficiency virus type 1 |
|---|
| Description: | P04585[489-587,L499I,L508Q,K509R,E524D,M525I,S526N,M535I,I539V,I543V,I551V,L552P,A560V,V571A,L579M] |
|---|
| Residue: | 99 |
|---|
| Sequence: | PQVTLWQRPIVTIKIGGQQREALLDTGADDTVLEDINLPGRWKPKIIGGVGGFVKVRQYD
QVPIEICGHKVIGTVLVGPTPANIIGRNLMTQIGCTLNF
|
|
|
|---|
| BDBM4690 |
|---|
| BDBM4685 |
|---|
| Name | BDBM4690 |
|---|
| Synonyms: | (3R,3aS,6aR)-hexahydrofuro[2,3-b]furan-3-yl N-[(2S,3R)-4-[2H-1,3-benzodioxole-5-(2-methylpropyl)sulfonamido]-3-hydroxy-1-[4-(pyridin-2-ylmethoxy)phenyl]butan-2-yl]carbamate | GW0385 analog 5 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C34H41N3O10S |
|---|
| Mol. Mass. | 683.768 |
|---|
| SMILES | [H][C@@]12CCO[C@]1([H])OC[C@@H]2OC(=O)N[C@@H](Cc1ccc(OCc2ccccn2)cc1)[C@H](O)CN(CC(C)C)S(=O)(=O)c1ccc2OCOc2c1 |r| |
|---|
| Structure | 
|
|---|
Search and Browse
