Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetCalcitonin gene-related peptide (CGRP alpha)
LigandBDBM126175
Substrate/Competitorn/a
Meas. Tech.Binding Assay
pH7.4±n/a
Temperature298.15±n/a K
Ki 17±n/a nM
Commentsextracted
Citation Stump CAQuigley AG CGRP receptor antagonists US Patent  US8778957 Publication Date 7/15/2014
More Info.:Get all data from this article,  Assay Method
 
Calcitonin gene-related peptide (CGRP alpha)
Name:Calcitonin gene-related peptide (CGRP alpha)
Synonyms:CGRP | Calcitonin gene-related peptide 1
Type:Enzyme
Mol. Mass.:13902.80
Organism:Homo sapiens (Human)
Description:P06881
Residue:128
Sequence:
MGFQKFSPFLALSILVLLQAGSLHAAPFRSALESSPADPATLSEDEARLLLAALVQNYVQ
MKASELEQEQEREGSRIIAQKRACDTATCVTHRLAGLLSRSGGVVKNNFVPTNVGSKAFG
RRRRDLQA
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM126175
n/a
NameBDBM126175
Synonyms:US8778957, 95
TypeSmall organic molecule
Emp. Form.C35H35N5O2
Mol. Mass.557.6847
SMILESCC1(Cc2ccccc2)N(Cc2ccc3cc4C[C@@]5(Cc4cc3n2)C(=O)Nc2ncccc52)CC2(CCCC2)NC1=O |r|
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: