| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Dimer of Gag-Pol polyprotein [489-587] |
|---|
| Ligand | BDBM4698 |
|---|
| Substrate/Competitor | BDBM4685 |
|---|
| Meas. Tech. | Kinetic Competitive Displacement Assay |
|---|
| pH | 5.5±n/a |
|---|
| Temperature | 303.15±n/a K |
|---|
| Ki | 0.000054±n/a nM |
|---|
| Comments | Ki=r*KiGW0385, r is determined at equilibrium from measured [E[3H]GW0385] and total concentrations of E, [3H]GW0385, and compound. |
|---|
| Citation |  Miller, JF; Furfine, ES; Hanlon, MH; Hazen, RJ; Ray, JA; Robinson, L; Samano, V; Spaltenstein, A Novel arylsulfonamides possessing sub-picomolar HIV protease activities and potent anti-HIV activity against wild-type and drug-resistant viral strains. Bioorg Med Chem Lett14:959-63 (2004) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Solution Info, Assay Method |
|---|
| |
| Dimer of Gag-Pol polyprotein [489-587] |
|---|
| Name: | Dimer of Gag-Pol polyprotein [489-587] |
|---|
| Synonyms: | HIV-1 Protease |
|---|
| Type: | Protein Complex |
|---|
| Mol. Mass.: | n/a |
|---|
| Description: | n/a |
|---|
| Components: | This complex has 2 components. |
|---|
| Component 1 |
| Name: | Gag-Pol polyprotein [489-587] |
|---|
| Synonyms: | HIV protease | HIV-1 Protease (NY5-type sequence) | HIV-1 Protease chain A | HIV-1 Protease chain B | POL_HV1N5 | gag-pol |
|---|
| Type: | Enzyme Subunit |
|---|
| Mol. Mass.: | 10822.21 |
|---|
| Organism: | Human immunodeficiency virus type 1 |
|---|
| Description: | P12497[489-587] |
|---|
| Residue: | 99 |
|---|
| Sequence: | PQITLWQRPLVTIKIGGQLKEALLDTGADDTVLEEMNLPGRWKPKMIGGIGGFIKVRQYD
QILIEICGHKAIGTVLVGPTPVNIIGRNLLTQIGCTLNF
|
|
|
|---|
| Component 2 |
| Name: | Gag-Pol polyprotein [489-587] |
|---|
| Synonyms: | HIV protease | HIV-1 Protease (NY5-type sequence) | HIV-1 Protease chain A | HIV-1 Protease chain B | POL_HV1N5 | gag-pol |
|---|
| Type: | Enzyme Subunit |
|---|
| Mol. Mass.: | 10822.21 |
|---|
| Organism: | Human immunodeficiency virus type 1 |
|---|
| Description: | P12497[489-587] |
|---|
| Residue: | 99 |
|---|
| Sequence: | PQITLWQRPLVTIKIGGQLKEALLDTGADDTVLEEMNLPGRWKPKMIGGIGGFIKVRQYD
QILIEICGHKAIGTVLVGPTPVNIIGRNLLTQIGCTLNF
|
|
|
|---|
| BDBM4698 |
|---|
| BDBM4685 |
|---|
| Name | BDBM4698 |
|---|
| Synonyms: | (3R,3aS,6aR)-hexahydrofuro[2,3-b]furan-3-yl N-[(2S,3R)-4-[2H-1,3-benzodioxole-5-(5-acetamido-2,2-dimethylpentyl)sulfonamido]-3-hydroxy-1-phenylbutan-2-yl]carbamate | arylsulfonamide 16a |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C33H45N3O10S |
|---|
| Mol. Mass. | 675.79 |
|---|
| SMILES | [H][C@@]12CCO[C@]1([H])OC[C@@H]2OC(=O)N[C@@H](Cc1ccccc1)[C@H](O)CN(CC(C)(C)CCCNC(C)=O)S(=O)(=O)c1ccc2OCOc2c1 |r| |
|---|
| Structure | 
|
|---|
Search and Browse
