Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetE3 ubiquitin-protein ligase Mdm2
LigandBDBM129893
Substrate/Competitorn/a
Meas. Tech.Time Resolved Fluorescence Energy Transfer (TR-FRET) Assay
IC50 0.11±n/a nM
Citation Furet PGuagnano VHolzer PKallen JLiao LMah RMao LMasuya KSchlapbach AStutz SVaupel A Substituted pyrrolo[3,4-D]imidazoles for the treatment of MDM2/4 mediated diseases US Patent  US8815926 Publication Date 8/26/2014
More Info.:Get all data from this article,  Assay Method
 
E3 ubiquitin-protein ligase Mdm2
Name:MDM2-MDMX
Synonyms:Double minute 2 protein | Double minute 2 protein (HDM2) | E3 ubiquitin-protein ligase Mdm2 (p53-binding protein Mdm2) | Hdm2 | Human Double Minute 2 (HDM2) | p53-Binding Protein MDM2 | p53-binding protein
Type:Oncoprotein
Mol. Mass.:55196.54
Organism:Homo sapiens (Human)
Description:n/a
Residue:491
Sequence:
MCNTNMSVPTDGAVTTSQIPASEQETLVRPKPLLLKLLKSVGAQKDTYTMKEVLFYLGQY
IMTKRLYDEKQQHIVYCSNDLLGDLFGVPSFSVKEHRKIYTMIYRNLVVVNQQESSDSGT
SVSENRCHLEGGSDQKDLVQELQEEKPSSSHLVSRPSTSSRRRAISETEENSDELSGERQ
RKRHKSDSISLSFDESLALCVIREICCERSSSSESTGTPSNPDLDAGVSEHSGDWLDQDS
VSDQFSVEFEVESLDSEDYSLSEEGQELSDEDDEVYQVTVYQAGESDTDSFEEDPEISLA
DYWKCTSCNEMNPPLPSHCNRCWALRENWLPEDKGKDKGEISEKAKLENSTQAEEGFDVP
DCKKTIVNDSRESCVEENDDKITQASQSQESEDYSQPSTSSSIIYSSQEDVKEFEREETQ
DKEESVESSLPLNAIEPCVICQGRPKNGCIVHGKTGHLMACFTCAKKLKKRNKPCPVCRQ
PIQMIVLTYFP
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM129893
n/a
NameBDBM129893
Synonyms:US8815926, 174
TypeSmall organic molecule
Emp. Form.C28H23Cl2FN4O3
Mol. Mass.553.412
SMILESCOc1ccc(cc1-c1nc2C(=O)N(C(c2n1C(C)C)c1ccc(Cl)cc1)c1cccc(Cl)c1F)C(N)=O
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: