Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetPhosphodiesterase 9A
LigandBDBM131013
Substrate/Competitorn/a
Meas. Tech.Inhibition Assay
Temperature303.15±n/a K
IC50 2±n/a nM
Commentsextracted
Citation Okada MSato SKawade KGotanda KShinbo ANakano YKobayashi H Substituted imidazo[1,5-A]quinoxalines as phosphodiesterase 9 inhibitors US Patent  US8829000 Publication Date 9/9/2014
More Info.:Get all data from this article,  Assay Method
 
Phosphodiesterase 9A
Name:3',5'-cyclic phosphodiesterase
Synonyms:High affinity cGMP-specific 3'',5''-cyclic phosphodiesterase 9A | Phosphodiesterase 9A (PDE9) | Phosphodiesterase 9A (PDE9A)
Type:Protein
Mol. Mass.:68488.40
Organism:Homo sapiens (Human)
Description:O76083
Residue:593
Sequence:
MGSGSSSYRPKAIYLDIDGRIQKVIFSKYCNSSDIMDLFCIATGLPRNTTISLLTTDDAM
VSIDPTMPANSERTPYKVRPVAIKQLSAGVEDKRTTSRGQSAERPLRDRRVVGLEQPRRE
GAFESGQVEPRPREPQGCYQEGQRIPPEREELIQSVLAQVAEQFSRAFKINELKAEVANH
LAVLEKRVELEGLKVVEIEKCKSDIKKMREELAARSSRTNCPCKYSFLDNHKKLTPRRDV
PTYPKYLLSPETIEALRKPTFDVWLWEPNEMLSCLEHMYHDLGLVRDFSINPVTLRRWLF
CVHDNYRNNPFHNFRHCFCVAQMMYSMVWLCSLQEKFSQTDILILMTAAICHDLDHPGYN
NTYQINARTELAVRYNDISPLENHHCAVAFQILAEPECNIFSNIPPDGFKQIRQGMITLI
LATDMARHAEIMDSFKEKMENFDYSNEEHMTLLKMILIKCCDISNEVRPMEVAEPWVDCL
LEEYFMQSDREKSEGLPVAPFMDRDKVTKATAQIGFIKFVLIPMFETVTKLFPMVEEIML
QPLWESRDRYEELKRIDDAMKELQKKTDSLTSGATEKSRERSRDVKNSEGDCA
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM131013
n/a
NameBDBM131013
Synonyms:US8829000, 185
TypeSmall organic molecule
Emp. Form.C15H15N3O3
Mol. Mass.285.2979
SMILESCCc1ccc2c(c1)[nH]c(=O)c1cnc(CCC(O)=O)n21
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: