| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Cyclin-dependent kinase 6 |
|---|
| Ligand | BDBM132281 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | In Vitro Assay |
|---|
| pH | 7.4±n/a |
|---|
| Temperature | 310.15±n/a K |
|---|
| IC50 | 5.1±n/a nM |
|---|
| Citation |  Connors, RV; Kang, D; Eksterowicz, J; Fan, P; Fisher, B; Fu, J; Li, K; Li, Z; McGee, LR; Sharma, R; Wang, X; McMinn, DL; Mihalic, JT; Deignan, J Fused pyridine, pyrimidine and triazine compounds as cell cycle inhibitors US Patent US8841312 Publication Date 9/23/2014 |
|---|
| More Info.: | Get all data from this article, Solution Info, Assay Method |
|---|
| |
| Cyclin-dependent kinase 6 |
|---|
| Name: | Cyclin-dependent kinase 6 |
|---|
| Synonyms: | CDK6 | CDK6_HUMAN | CDKN6 | Cell division protein kinase 6 | Cyclin-dependent kinase 6 (CDK 6) | Serine/threonine-protein kinase PLSTIRE |
|---|
| Type: | Enzyme Subunit |
|---|
| Mol. Mass.: | 36937.42 |
|---|
| Organism: | Homo sapiens (Human) |
|---|
| Description: | Q00534 |
|---|
| Residue: | 326 |
|---|
| Sequence: | MEKDGLCRADQQYECVAEIGEGAYGKVFKARDLKNGGRFVALKRVRVQTGEEGMPLSTIR
EVAVLRHLETFEHPNVVRLFDVCTVSRTDRETKLTLVFEHVDQDLTTYLDKVPEPGVPTE
TIKDMMFQLLRGLDFLHSHRVVHRDLKPQNILVTSSGQIKLADFGLARIYSFQMALTSVV
VTLWYRAPEVLLQSSYATPVDLWSVGCIFAEMFRRKPLFRGSSDVDQLGKILDVIGLPGE
EDWPRDVALPRQAFHSKSAQPIEKFVTDIDELGKDLLLKCLTFNPAKRISAYSALSHPYF
QDLERCKENLDSHLPPSQNTSELNTA
|
|
|
|---|
| BDBM132281 |
|---|
| n/a |
|---|
| Name | BDBM132281 |
|---|
| Synonyms: | US8841312, 24 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C25H28N8 |
|---|
| Mol. Mass. | 440.5434 |
|---|
| SMILES | C1CC2CC1CC2n1c2cnccc2c2cnc(Nc3ccc(cn3)N3CCNCC3)nc12 |THB:7:6:0.1:3| |
|---|
| Structure | 
|
|---|
Search and Browse
