| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Cyclin-dependent kinase 6 |
|---|
| Ligand | BDBM132294 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | In Vitro Assay |
|---|
| pH | 7.4±n/a |
|---|
| Temperature | 310.15±n/a K |
|---|
| IC50 | 1.2±n/a nM |
|---|
| Citation |  Connors RV; Kang D; Eksterowicz J; Fan P; Fisher B; Fu J; Li K; Li Z; McGee LR; Sharma R; Wang X; McMinn DL; Mihalic JT; Deignan J Fused pyridine, pyrimidine and triazine compounds as cell cycle inhibitors US Patent US8841312 Publication Date 9/23/2014 |
|---|
| More Info.: | Get all data from this article, Solution Info, Assay Method |
|---|
| |
| Cyclin-dependent kinase 6 |
|---|
| Name: | Cyclin-dependent kinase 6 |
|---|
| Synonyms: | CDK6 | CDKN6 | Cell division protein kinase 6 | Cyclin-dependent kinase 6 (CDK 6) | Serine/threonine-protein kinase PLSTIRE |
|---|
| Type: | Enzyme Subunit |
|---|
| Mol. Mass.: | 36937.42 |
|---|
| Organism: | Homo sapiens (Human) |
|---|
| Description: | Q00534 |
|---|
| Residue: | 326 |
|---|
| Sequence: | MEKDGLCRADQQYECVAEIGEGAYGKVFKARDLKNGGRFVALKRVRVQTGEEGMPLSTIR
EVAVLRHLETFEHPNVVRLFDVCTVSRTDRETKLTLVFEHVDQDLTTYLDKVPEPGVPTE
TIKDMMFQLLRGLDFLHSHRVVHRDLKPQNILVTSSGQIKLADFGLARIYSFQMALTSVV
VTLWYRAPEVLLQSSYATPVDLWSVGCIFAEMFRRKPLFRGSSDVDQLGKILDVIGLPGE
EDWPRDVALPRQAFHSKSAQPIEKFVTDIDELGKDLLLKCLTFNPAKRISAYSALSHPYF
QDLERCKENLDSHLPPSQNTSELNTA
|
|
|
|---|
| BDBM132294 |
|---|
| n/a |
|---|
| Name | BDBM132294 |
|---|
| Synonyms: | US8841312, 37 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C24H27N7 |
|---|
| Mol. Mass. | 413.5181 |
|---|
| SMILES | C1CCC(C1)n1c2ccccc2c2cnc(Nc3ccc(cn3)N3CCNCC3)nc12 |
|---|
| Structure | 
|
|---|
Search and Browse
