Reaction Details |
| Report a problem with these data |
Target | Cyclin-dependent kinase 6 |
---|
Ligand | BDBM132471 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | In Vitro Assay |
---|
pH | 7.4±n/a |
---|
Temperature | 310.15±n/a K |
---|
IC50 | 3.3±n/a nM |
---|
Citation | Connors, RV; Kang, D; Eksterowicz, J; Fan, P; Fisher, B; Fu, J; Li, K; Li, Z; McGee, LR; Sharma, R; Wang, X; McMinn, DL; Mihalic, JT; Deignan, J Fused pyridine, pyrimidine and triazine compounds as cell cycle inhibitors US Patent US8841312 Publication Date 9/23/2014 |
---|
More Info.: | Get all data from this article, Solution Info, Assay Method |
---|
|
Cyclin-dependent kinase 6 |
---|
Name: | Cyclin-dependent kinase 6 |
Synonyms: | CDK6 | CDK6_HUMAN | CDKN6 | Cell division protein kinase 6 | Cyclin-dependent kinase 6 (CDK 6) | Serine/threonine-protein kinase PLSTIRE |
Type: | Enzyme Subunit |
Mol. Mass.: | 36937.42 |
Organism: | Homo sapiens (Human) |
Description: | Q00534 |
Residue: | 326 |
Sequence: | MEKDGLCRADQQYECVAEIGEGAYGKVFKARDLKNGGRFVALKRVRVQTGEEGMPLSTIR
EVAVLRHLETFEHPNVVRLFDVCTVSRTDRETKLTLVFEHVDQDLTTYLDKVPEPGVPTE
TIKDMMFQLLRGLDFLHSHRVVHRDLKPQNILVTSSGQIKLADFGLARIYSFQMALTSVV
VTLWYRAPEVLLQSSYATPVDLWSVGCIFAEMFRRKPLFRGSSDVDQLGKILDVIGLPGE
EDWPRDVALPRQAFHSKSAQPIEKFVTDIDELGKDLLLKCLTFNPAKRISAYSALSHPYF
QDLERCKENLDSHLPPSQNTSELNTA
|
|
|
BDBM132471 |
---|
n/a |
---|
Name | BDBM132471 |
Synonyms: | US8841312, 220 |
Type | Small organic molecule |
Emp. Form. | C26H30N8O2 |
Mol. Mass. | 486.5688 |
SMILES | OC(=O)CN1CCN(Cc2ccc(Nc3ncc4c5ccncc5n(C5CCCC5)c4n3)nc2)CC1 |
Structure |
|