Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetCyclin-dependent kinase 6
LigandBDBM132714
Substrate/Competitorn/a
Meas. Tech.In Vitro Assay
pH7.4±n/a
Temperature310.15±n/a K
IC50 3.1±n/a nM
Citation Connors RVKang DEksterowicz JFan PFisher BFu JLi KLi ZMcGee LRSharma RWang XMcMinn DLMihalic JTDeignan J Fused pyridine, pyrimidine and triazine compounds as cell cycle inhibitors US Patent  US8841312 Publication Date 9/23/2014
More Info.:Get all data from this article,   Solution Info,  Assay Method
 
Cyclin-dependent kinase 6
Name:Cyclin-dependent kinase 6
Synonyms:CDK6 | CDKN6 | Cell division protein kinase 6 | Cyclin-dependent kinase 6 (CDK 6) | Serine/threonine-protein kinase PLSTIRE
Type:Enzyme Subunit
Mol. Mass.:36937.42
Organism:Homo sapiens (Human)
Description:Q00534
Residue:326
Sequence:
MEKDGLCRADQQYECVAEIGEGAYGKVFKARDLKNGGRFVALKRVRVQTGEEGMPLSTIR
EVAVLRHLETFEHPNVVRLFDVCTVSRTDRETKLTLVFEHVDQDLTTYLDKVPEPGVPTE
TIKDMMFQLLRGLDFLHSHRVVHRDLKPQNILVTSSGQIKLADFGLARIYSFQMALTSVV
VTLWYRAPEVLLQSSYATPVDLWSVGCIFAEMFRRKPLFRGSSDVDQLGKILDVIGLPGE
EDWPRDVALPRQAFHSKSAQPIEKFVTDIDELGKDLLLKCLTFNPAKRISAYSALSHPYF
QDLERCKENLDSHLPPSQNTSELNTA
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM132714
n/a
NameBDBM132714
Synonyms:US8841312, 464
TypeSmall organic molecule
Emp. Form.C26H32N8
Mol. Mass.456.5859
SMILESCCNC1CCN(CC1)c1ccc(Nc2ncc3c4ccncc4n(C4CCCC4)c3n2)nc1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: