Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetcAMP-specific 3',5'-cyclic phosphodiesterase 4A isoform 3
LigandBDBM285536
Substrate/Competitorn/a
Meas. Tech.The PDE4A3, PDE4B1, PDE4C1 and PDE4D3 assays
IC50 3.83±n/a nM
Citation Chappie TAPatel NCHayward MMHelal CJSciabola SLaChapelle EAYoung JMVerhoest PR Imidazopyridazine compounds US Patent  US10077269 Publication Date 9/18/2018
More Info.:Get all data from this article,  Assay Method
 
cAMP-specific 3',5'-cyclic phosphodiesterase 4A isoform 3
Name:cAMP-specific 3',5'-cyclic phosphodiesterase 4A isoform 3
Synonyms:NP_001104779 | PDE4A
Type:Enzyme Catalytic Domain
Mol. Mass.:91000.95
Organism:Homo sapiens (Human)
Description:n/a
Residue:823
Sequence:
SGAAPRARPRPPALALPPTGPESLTHFPFSDEDTRRHPPGRSVSFEAENGPTPSPGRSPL
DSQASPGLVLHAGAATSQRRESFLYRSDSDYDMSPKTMSRNSSVTSEAHAEDLIVTPFAQ
VLASLRSVRSNFSLLTNVPVPSNKRSPLGGPTPVCKATLSEETCQQLARETLEELDWCLE
QLETMQTYRSVSEMASHKFKRMLNRELTHLSEMSRSGNQVSEYISTTFLDKQNEVEIPSP
TMKEREKQQAPRPRPSQPPPPPVPHLQPMSQITGLKKLMHSNSLNNSNIPRFGVKTDQEE
LLAQELENLNKWGLNIFCVSDYAGGRSLTCIMYMIFQERDLLKKFRIPVDTMVTYMLTLE
DHYHADVAYHNSLHAADVLQSTHVLLATPALDAVFTDLEILAALFAAAIHDVDHPGVSNQ
FLINTNSELALMYNDESVLENHHLAVGFKLLQEDNCDIFQNLSKRQRQSLRKMVIDMVLA
TDMSKHMTLLADLKTMVETKKVTSSGVLLLDNYSDRIQVLRNMVHCADLSNPTKPLELYR
QWTDRIMAEFFQQGDRERERGMEISPMCDKHTASVEKSQVGFIDYIVHPLWETWADLVHP
DAQEILDTLEDNRDWYYSAIRQSPSPPPEEESRGPGHPPLPDKFQFELTLEEEEEEEISM
AQIPCTAQEALTAQGLSGVEEALDATIAWEASPAQESLEVMAQEASLEAELEAVYLTQQA
QSTGSAPVAPDEFSSREEFVVAVSHSSPSALALQSPLLPAWRTLSVSEHAPGLPGLPSTA
AEVEAQREHQAAKRACSACAGTFGEDTSALPAPGGGGSGGDPT
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM285536
n/a
NameBDBM285536
Synonyms:3-(4-Chloro-2,5-difluorophenyl)-N-cyclopropylimidazo[1,2-b]pyridazine-2-carboxamide (9) | US10077269, Example 9 | US9598421, Example 9
TypeSmall organic molecule
Emp. Form.C16H11ClF2N4O
Mol. Mass.348.735
SMILESFc1cc(-c2c(nc3cccnn23)C(=O)NC2CC2)c(F)cc1Cl |(8.76,-6.6,;7.27,-7,;6.88,-8.49,;5.39,-8.89,;4.99,-10.38,;5.89,-11.62,;4.99,-12.87,;3.52,-12.39,;2.19,-13.16,;.86,-12.39,;.86,-10.85,;2.19,-10.08,;3.52,-10.85,;7.44,-11.62,;8.21,-10.29,;8.21,-12.96,;9.75,-12.96,;11.08,-13.73,;11.08,-12.19,;4.3,-7.8,;2.81,-8.2,;4.7,-6.31,;6.19,-5.91,;6.58,-4.43,)|
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: