Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetcAMP-specific 3',5'-cyclic phosphodiesterase 4D
LigandBDBM285574
Substrate/Competitorn/a
Meas. Tech.The PDE4A3, PDE4B1, PDE4C1 and PDE4D3 assays
IC50 334±n/a nM
Citation Chappie TAPatel NCHayward MMHelal CJSciabola SLaChapelle EAYoung JMVerhoest PR Imidazopyridazine compounds US Patent  US10077269 Publication Date 9/18/2018
More Info.:Get all data from this article,  Assay Method
 
cAMP-specific 3',5'-cyclic phosphodiesterase 4D
Name:Isoform 3 of cAMP-specific 3',5'-cyclic phosphodiesterase 4D
Synonyms:NP_000914.2 | PDE4C1 | PDE4D3 | PDE4E3 | Q08499-2
Type:n/a
Mol. Mass.:76431.39
Organism:Homo sapiens (Human)
Description:Q08499-2
Residue:673
Sequence:
MMHVNNFPFRRHSWICFDVDNGTSAGRSPLDPMTSPGSGLILQANFVHSQRRESFLYRSD
SDYDLSPKSMSRNSSIASDIHGDDLIVTPFAQVLASLRTVRNNFAALTNLQDRAPSKRSP
MCNQPSINKATITEEAYQKLASETLEELDWCLDQLETLQTRHSVSEMASNKFKRMLNREL
THLSEMSRSGNQVSEFISNTFLDKQHEVEIPSPTQKEKEKKKRPMSQISGVKKLMHSSSL
TNSSIPRFGVKTEQEDVLAKELEDVNKWGLHVFRIAELSGNRPLTVIMHTIFQERDLLKT
FKIPVDTLITYLMTLEDHYHADVAYHNNIHAADVVQSTHVLLSTPALEAVFTDLEILAAI
FASAIHDVDHPGVSNQFLINTNSELALMYNDSSVLENHHLAVGFKLLQEENCDIFQNLTK
KQRQSLRKMVIDIVLATDMSKHMNLLADLKTMVETKKVTSSGVLLLDNYSDRIQVLQNMV
HCADLSNPTKPLQLYRQWTDRIMEEFFRQGDRERERGMEISPMCDKHNASVEKSQVGFID
YIVHPLWETWADLVHPDAQDILDTLEDNREWYQSTIPQSPSPAPDDPEEGRQGQTEKFQF
ELTLEEDGESDTEKDSGSQVEEDTSCSDSKTLCTQDSESTEIPLDEQVEEEAVGEEEESQ
PEACVIDDRSPDT
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM285574
n/a
NameBDBM285574
Synonyms:US10077269, Example 47 | US9598421, Example 47 | azetidin-1-yl[3-(4-chloro-3,5-difluorophenyl)imidazo[1,2-b]pyridazin-2-yl]methanone
TypeSmall organic molecule
Emp. Form.C16H11ClF2N4O
Mol. Mass.348.735
SMILESFc1cc(cc(F)c1Cl)-c1c(nc2cccnn12)C(=O)N1CCC1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: