Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetcAMP-specific 3',5'-cyclic phosphodiesterase 4A isoform 3
LigandBDBM285627
Substrate/Competitorn/a
Meas. Tech.The PDE4A3, PDE4B1, PDE4C1 and PDE4D3 assays
IC50 5.48±n/a nM
Citation Chappie TAPatel NCHayward MMHelal CJSciabola SLaChapelle EAYoung JMVerhoest PR Imidazopyridazine compounds US Patent  US10077269 Publication Date 9/18/2018
More Info.:Get all data from this article,  Assay Method
 
cAMP-specific 3',5'-cyclic phosphodiesterase 4A isoform 3
Name:cAMP-specific 3',5'-cyclic phosphodiesterase 4A isoform 3
Synonyms:NP_001104779 | PDE4A
Type:Enzyme Catalytic Domain
Mol. Mass.:91000.95
Organism:Homo sapiens (Human)
Description:n/a
Residue:823
Sequence:
SGAAPRARPRPPALALPPTGPESLTHFPFSDEDTRRHPPGRSVSFEAENGPTPSPGRSPL
DSQASPGLVLHAGAATSQRRESFLYRSDSDYDMSPKTMSRNSSVTSEAHAEDLIVTPFAQ
VLASLRSVRSNFSLLTNVPVPSNKRSPLGGPTPVCKATLSEETCQQLARETLEELDWCLE
QLETMQTYRSVSEMASHKFKRMLNRELTHLSEMSRSGNQVSEYISTTFLDKQNEVEIPSP
TMKEREKQQAPRPRPSQPPPPPVPHLQPMSQITGLKKLMHSNSLNNSNIPRFGVKTDQEE
LLAQELENLNKWGLNIFCVSDYAGGRSLTCIMYMIFQERDLLKKFRIPVDTMVTYMLTLE
DHYHADVAYHNSLHAADVLQSTHVLLATPALDAVFTDLEILAALFAAAIHDVDHPGVSNQ
FLINTNSELALMYNDESVLENHHLAVGFKLLQEDNCDIFQNLSKRQRQSLRKMVIDMVLA
TDMSKHMTLLADLKTMVETKKVTSSGVLLLDNYSDRIQVLRNMVHCADLSNPTKPLELYR
QWTDRIMAEFFQQGDRERERGMEISPMCDKHTASVEKSQVGFIDYIVHPLWETWADLVHP
DAQEILDTLEDNRDWYYSAIRQSPSPPPEEESRGPGHPPLPDKFQFELTLEEEEEEEISM
AQIPCTAQEALTAQGLSGVEEALDATIAWEASPAQESLEVMAQEASLEAELEAVYLTQQA
QSTGSAPVAPDEFSSREEFVVAVSHSSPSALALQSPLLPAWRTLSVSEHAPGLPGLPSTA
AEVEAQREHQAAKRACSACAGTFGEDTSALPAPGGGGSGGDPT
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM285627
n/a
NameBDBM285627
Synonyms:3-(4-chloro-5-fluoro-2-methylphenyl)-N-(propan-2-yl)imidazo[1,2-b]pyridazine-2-carboxamide | US10077269, Example 97 | US9598421, Example 97
TypeSmall organic molecule
Emp. Form.C17H16ClFN4O
Mol. Mass.346.787
SMILESCC(C)NC(=O)c1nc2cccnn2c1-c1cc(F)c(Cl)cc1C |(4.83,-2.26,;4.06,-3.6,;4.83,-4.93,;2.52,-3.6,;1.75,-2.26,;2.52,-.93,;.21,-2.26,;-.7,-3.51,;-2.16,-3.03,;-3.49,-3.8,;-4.83,-3.03,;-4.83,-1.49,;-3.49,-.72,;-2.16,-1.49,;-.7,-1.02,;-.3,.47,;1.19,.87,;1.59,2.36,;3.08,2.75,;.5,3.44,;.9,4.93,;-.99,3.05,;-1.39,1.56,;-2.87,1.16,)|
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: