| Reaction Details |
|---|
 | Report a problem with these data |
| Target | C5a anaphylatoxin chemotactic receptor 1 |
|---|
| Ligand | BDBM134545 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | FLIPR Assay |
|---|
| IC50 | 4±n/a nM |
|---|
| Citation |  Adams, CM; Darsigny, V; Flyer, AN; Gelin, CF; Hurley, TB; Ji, N; Karki, RG; Kawanami, T; Meredith, E; Rao, C; Serrano-Wu, MH; Solovay, CF Tetrahydropyrido-pyridine and tetrahydropyrido-pyrimidine compounds and use thereof as C5a receptor modulators US Patent US8846656 Publication Date 9/30/2014 |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| C5a anaphylatoxin chemotactic receptor 1 |
|---|
| Name: | C5a anaphylatoxin chemotactic receptor 1 |
|---|
| Synonyms: | C5AR | C5AR1 | C5AR1_HUMAN | C5R1 | C5a anaphylatoxin chemotactic receptor | C5a anaphylatoxin chemotactic receptor (C5aR) | C5a-R | CD_antigen=CD88 |
|---|
| Type: | Enzyme |
|---|
| Mol. Mass.: | 39347.68 |
|---|
| Organism: | Homo sapiens (Human) |
|---|
| Description: | P21730 |
|---|
| Residue: | 350 |
|---|
| Sequence: | MDSFNYTTPDYGHYDDKDTLDLNTPVDKTSNTLRVPDILALVIFAVVFLVGVLGNALVVW
VTAFEAKRTINAIWFLNLAVADFLSCLALPILFTSIVQHHHWPFGGAACSILPSLILLNM
YASILLLATISADRFLLVFKPIWCQNFRGAGLAWIACAVAWGLALLLTIPSFLYRVVREE
YFPPKVLCGVDYSHDKRRERAVAIVRLVLGFLWPLLTLTICYTFILLRTWSRRATRSTKT
LKVVVAVVASFFIFWLPYQVTGIMMSFLEPSSPTFLLLKKLDSLCVSFAYINCCINPIIY
VVAGQGFQGRLRKSLPSLLRNVLTEESVVRESKSFTRSTVDTMAQKTQAV
|
|
|
|---|
| BDBM134545 |
|---|
| n/a |
|---|
| Name | BDBM134545 |
|---|
| Synonyms: | US8846656, 28-D |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C34H43N7O |
|---|
| Mol. Mass. | 565.7515 |
|---|
| SMILES | CC(C)c1ccc(C)c(c1)N1CCc2nc(nc(N3C[C@H](C)N(CC(N)=O)C[C@H]3C)c2C1)-c1cccc2[nH]cc(C)c12 |r| |
|---|
| Structure | 
|
|---|
Search and Browse
