Reaction Details |
| Report a problem with these data |
Target | C5a anaphylatoxin chemotactic receptor 1 |
---|
Ligand | BDBM134509 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | FLIPR Assay |
---|
IC50 | 2±n/a nM |
---|
Citation | Adams, CM; Darsigny, V; Flyer, AN; Gelin, CF; Hurley, TB; Ji, N; Karki, RG; Kawanami, T; Meredith, E; Rao, C; Serrano-Wu, MH; Solovay, CF Tetrahydropyrido-pyridine and tetrahydropyrido-pyrimidine compounds and use thereof as C5a receptor modulators US Patent US8846656 Publication Date 9/30/2014 |
---|
More Info.: | Get all data from this article, Assay Method |
---|
|
C5a anaphylatoxin chemotactic receptor 1 |
---|
Name: | C5a anaphylatoxin chemotactic receptor 1 |
Synonyms: | C5AR | C5AR1 | C5AR1_HUMAN | C5R1 | C5a anaphylatoxin chemotactic receptor | C5a anaphylatoxin chemotactic receptor (C5aR) | C5a-R | CD_antigen=CD88 |
Type: | Enzyme |
Mol. Mass.: | 39347.68 |
Organism: | Homo sapiens (Human) |
Description: | P21730 |
Residue: | 350 |
Sequence: | MDSFNYTTPDYGHYDDKDTLDLNTPVDKTSNTLRVPDILALVIFAVVFLVGVLGNALVVW
VTAFEAKRTINAIWFLNLAVADFLSCLALPILFTSIVQHHHWPFGGAACSILPSLILLNM
YASILLLATISADRFLLVFKPIWCQNFRGAGLAWIACAVAWGLALLLTIPSFLYRVVREE
YFPPKVLCGVDYSHDKRRERAVAIVRLVLGFLWPLLTLTICYTFILLRTWSRRATRSTKT
LKVVVAVVASFFIFWLPYQVTGIMMSFLEPSSPTFLLLKKLDSLCVSFAYINCCINPIIY
VVAGQGFQGRLRKSLPSLLRNVLTEESVVRESKSFTRSTVDTMAQKTQAV
|
|
|
BDBM134509 |
---|
n/a |
---|
Name | BDBM134509 |
Synonyms: | US8846656, 21-N |
Type | Small organic molecule |
Emp. Form. | C30H38N4O2 |
Mol. Mass. | 486.6483 |
SMILES | CO[C@@H]1CCN([C@H](C)C1)c1nc(nc2CCN(Cc12)c1cc(OC)ccc1C)-c1c(C)cccc1C |r| |
Structure |
|