Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetPurine Nucleoside Phosphorylase (PNP)
LigandBDBM136305
Substrate/Competitorn/a
Meas. Tech.Inhibition Assay
Temperature298.15±n/a K
Kd 3500±n/a nM
Commentsextracted
Citation Clinch KEvans GBFurneaux RHGulab SAKelly PMSchramm VLTyler PCWoolhouse AD Acyclic amine inhibitors of nucleoside phosphorylases and hydrolases US Patent  US8853224 Publication Date 10/7/2014
More Info.:Get all data from this article,  Assay Method
 
Purine Nucleoside Phosphorylase (PNP)
Name:Purine Nucleoside Phosphorylase (PNP)
Synonyms:pfPNP
Type:Enzyme
Mol. Mass.:26857.85
Organism:Plasmodium falciparum
Description:n/a
Residue:245
Sequence:
MDNLLRHLKISKEQITPVVLVVGDPGRVDKIKVVCDSYVDLAYNREYKSVECHYKGQKFL
CVSHGVGSAGCAVCFEELCQNGAKVIIRAGSCGSLQPDLIKRGDICICNAAVREDRVSHL
LIHGDFPAVGDFDVYDTLNKCAQELNVPVFNGISVSSDMYYPNKIIPSRLEDYSKANAAV
VEMELATLMVIGTLRKVKTGGILIVDGCPFKWDEGDFDNNLVPHQLENMIKIALGACAKL
ATKYA
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM136305
n/a
NameBDBM136305
Synonyms:US8853224, 22
TypeSmall organic molecule
Emp. Form.C12H18N4O4
Mol. Mass.282.2957
SMILESOC[C@@H](O)C(CO)CNCc1c[nH]c2c1nc[nH]c2=O
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: