Reaction Details |
| Report a problem with these data |
Target | Regulator of G-protein signaling 4 |
---|
Ligand | BDBM50384774 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | Inhibitory Assay |
---|
IC50 | 30±n/a nM |
---|
Citation | Neubig, R; Blazer, L; Husbands, S; Larsen, S; Traynor, J Small molecule inhibitors of RGS proteins US Patent US8865750 Publication Date 10/21/2014 |
---|
More Info.: | Get all data from this article, Assay Method |
---|
|
Regulator of G-protein signaling 4 |
---|
Name: | Regulator of G-protein signaling 4 |
Synonyms: | RGP4 | RGS4 | RGS4_HUMAN | Regulator of G-protein signaling 4 (RGS4) |
Type: | Enzyme |
Mol. Mass.: | 23263.51 |
Organism: | Homo sapiens (Human) |
Description: | P49798 |
Residue: | 205 |
Sequence: | MCKGLAGLPASCLRSAKDMKHRLGFLLQKSDSCEHNSSHNKKDKVVICQRVSQEEVKKWA
ESLENLISHECGLAAFKAFLKSEYSEENIDFWISCEEYKKIKSPSKLSPKAKKIYNEFIS
VQATKEVNLDSCTREETSRNMLEPTITCFDEAQKKIFNLMEKDSYRRFLKSRFYLDLVNP
SSCGAEKQKGAKSSADCASLVPQCA
|
|
|
BDBM50384774 |
---|
n/a |
---|
Name | BDBM50384774 |
Synonyms: | CHEMBL1917204 | US20230414581, Compound 6 |
Type | Small organic molecule |
Emp. Form. | C16H13FN2O2S |
Mol. Mass. | 316.35 |
SMILES | Cc1ccc(cc1)-n1sc(=O)n(Cc2ccc(F)cc2)c1=O |
Structure |
|