| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Peptidyl-prolyl cis-trans isomerase A |
|---|
| Ligand | BDBM285729 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | Protease-Free PPIase Assay |
|---|
| pH | 7.8±n/a |
|---|
| Ki | 5.60±n/a nM |
|---|
| Comments | extracted |
|---|
| Citation |  Pettit, SN; Jones, AD; Frydrych, CS; Thomas, AJ; Garst, ME Cyclosporins modified on the MeBmt sidechain by heterocyclic rings US Patent US10077289 Publication Date 9/18/2018 |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Peptidyl-prolyl cis-trans isomerase A |
|---|
| Name: | Peptidyl-prolyl cis-trans isomerase A |
|---|
| Synonyms: | CYPA | CYPA PPIase | Cyclophilin A | Cyclosporin A-binding protein | PPIA | PPIA_HUMAN | PPIase A | Peptidyl-prolyl cis-trans isomerase A | Rotamase A |
|---|
| Type: | Protein |
|---|
| Mol. Mass.: | 18015.32 |
|---|
| Organism: | Homo sapiens (Human) |
|---|
| Description: | P62937 |
|---|
| Residue: | 165 |
|---|
| Sequence: | MVNPTVFFDIAVDGEPLGRVSFELFADKVPKTAENFRALSTGEKGFGYKGSCFHRIIPGF
MCQGGDFTRHNGTGGKSIYGEKFEDENFILKHTGPGILSMANAGPNTNGSQFFICTAKTE
WLDGKHVVFGKVKEGMNIVEAMERFGSRNGKTSKKITIADCGQLE
|
|
|
|---|
| BDBM285729 |
|---|
| n/a |
|---|
| Name | BDBM285729 |
|---|
| Synonyms: | US10077289, Compound 37 | [(2S,3R,4R)-3-Hydroxy-4-methyl-2-(methylamino)-6-(pyridin-4-ylmethoxy)-hexanoic acid]1 cyclosporin A |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C67H116N12O13 |
|---|
| Mol. Mass. | 1297.7105 |
|---|
| SMILES | CC[C@H]1NC(=O)[C@@H]([C@H](O)[C@H](C)CCOCc2ccncc2)N(C)C(=O)[C@@H](C(C)C)N(C)C(=O)[C@@H](CC(C)C)N(C)C(=O)[C@@H](CC(C)C)N(C)C(=O)[C@H](C)NC(=O)[C@@H](C)NC(=O)[C@@H](CC(C)C)N(C)C(=O)[C@H](NC(=O)[C@H](CC(C)C)N(C)C(=O)[C@@H](C)N(C)C1=O)C(C)C |r| |
|---|
| Structure | 
|
|---|
Search and Browse
