Reaction Details |
| Report a problem with these data |
Target | 5-hydroxytryptamine receptor 2C |
---|
Ligand | BDBM22869 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | Receptor Selection and Amplification Technology |
---|
IC50 | 2.0e+2±1.1e+2 nM |
---|
Citation | Vanover, KE; Weiner, DM; Makhay, M; Veinbergs, I; Gardell, LR; Lameh, J; Del Tredici, AL; Piu, F; Schiffer, HH; Ott, TR; Burstein, ES; Uldam, AK; Thygesen, MB; Schlienger, N; Andersson, CM; Son, TY; Harvey, SC; Powell, SB; Geyer, MA; Tolf, BR; Brann, MR; Davis, RE Pharmacological and behavioral profile of N-(4-fluorophenylmethyl)-N-(1-methylpiperidin-4-yl)-N'-(4-(2-methylpropyloxy)phenylmethyl) carbamide (2R,3R)-dihydroxybutanedioate (2:1) (ACP-103), a novel 5-hydroxytryptamine(2A) receptor inverse agonist. J Pharmacol Exp Ther317:910-8 (2006) [PubMed] Article |
---|
More Info.: | Get all data from this article, Assay Method |
---|
|
5-hydroxytryptamine receptor 2C |
---|
Name: | 5-hydroxytryptamine receptor 2C |
Synonyms: | 5-HT-2C | 5-HT2C | 5-HT2C-INI | 5-HT2c VGI | 5-HTR2C | 5-hydroxytryptamine receptor 1C | 5-hydroxytryptamine receptor 2C (5-HT-2C) | 5-hydroxytryptamine receptor 2C (5HT-2C) | 5HT-1C | 5HT2C_HUMAN | HTR1C | HTR2C | Serotonin (5-HT3) receptor | Serotonin 2c (5-HT2c) receptor | Serotonin Receptor 2C |
Type: | G Protein-Coupled Receptor (GPCR) |
Mol. Mass.: | 51836.79 |
Organism: | Homo sapiens (Human) |
Description: | P28335 |
Residue: | 458 |
Sequence: | MVNLRNAVHSFLVHLIGLLVWQCDISVSPVAAIVTDIFNTSDGGRFKFPDGVQNWPALSI
VIIIIMTIGGNILVIMAVSMEKKLHNATNYFLMSLAIADMLVGLLVMPLSLLAILYDYVW
PLPRYLCPVWISLDVLFSTASIMHLCAISLDRYVAIRNPIEHSRFNSRTKAIMKIAIVWA
ISIGVSVPIPVIGLRDEEKVFVNNTTCVLNDPNFVLIGSFVAFFIPLTIMVITYCLTIYV
LRRQALMLLHGHTEEPPGLSLDFLKCCKRNTAEEENSANPNQDQNARRRKKKERRPRGTM
QAINNERKASKVLGIVFFVFLIMWCPFFITNILSVLCEKSCNQKLMEKLLNVFVWIGYVC
SGINPLVYTLFNKIYRRAFSNYLRCNYKVEKKPPVRQIPRVAATALSGRELNVNIYRHTN
EPVIEKASDNEPGIEMQVENLELPVNPSSVVSERISSV
|
|
|
BDBM22869 |
---|
n/a |
---|
Name | BDBM22869 |
Synonyms: | 6-chloro-10-(4-methylpiperazin-1-yl)-2,9-diazatricyclo[9.4.0.0^{3,8}]pentadeca-1,3(8),4,6,10,12,14-heptaene | CLOZARIL | Clozapine | Leponex | US10259786, Clozapine |
Type | Small organic molecule |
Emp. Form. | C18H19ClN4 |
Mol. Mass. | 326.823 |
SMILES | CN1CCN(CC1)C1=c2ccccc2=Nc2ccc(Cl)cc2N1 |c:8,15| |
Structure |
|