| Reaction Details |
|---|
 | Report a problem with these data |
| Target | 5-hydroxytryptamine receptor 2A |
|---|
| Ligand | BDBM139370 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | Radioligand Binding Assay |
|---|
| Temperature | 277.15±n/a K |
|---|
| Ki | 0.5±0.16 nM |
|---|
| Comments | extracted |
|---|
| Citation |  Vanover, KE; Weiner, DM; Makhay, M; Veinbergs, I; Gardell, LR; Lameh, J; Del Tredici, AL; Piu, F; Schiffer, HH; Ott, TR; Burstein, ES; Uldam, AK; Thygesen, MB; Schlienger, N; Andersson, CM; Son, TY; Harvey, SC; Powell, SB; Geyer, MA; Tolf, BR; Brann, MR; Davis, RE Pharmacological and behavioral profile of N-(4-fluorophenylmethyl)-N-(1-methylpiperidin-4-yl)-N'-(4-(2-methylpropyloxy)phenylmethyl) carbamide (2R,3R)-dihydroxybutanedioate (2:1) (ACP-103), a novel 5-hydroxytryptamine(2A) receptor inverse agonist. J Pharmacol Exp Ther317:910-8 (2006) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| 5-hydroxytryptamine receptor 2A |
|---|
| Name: | 5-hydroxytryptamine receptor 2A |
|---|
| Synonyms: | 5-HT-2 | 5-HT-2A | 5-HT2A | 5-hydroxytryptamine receptor 2A (5-HT-2A) | 5-hydroxytryptamine receptor 2A (5HT-2A) | 5-hydroxytryptamine receptor 2A (5HT2A) | 5HT2A_HUMAN | HTR2 | HTR2A | Serotonin receptor 2A |
|---|
| Type: | undefined |
|---|
| Mol. Mass.: | 52607.65 |
|---|
| Organism: | Homo sapiens (Human) |
|---|
| Description: | P28223 |
|---|
| Residue: | 471 |
|---|
| Sequence: | MDILCEENTSLSSTTNSLMQLNDDTRLYSNDFNSGEANTSDAFNWTVDSENRTNLSCEGC
LSPSCLSLLHLQEKNWSALLTAVVIILTIAGNILVIMAVSLEKKLQNATNYFLMSLAIAD
MLLGFLVMPVSMLTILYGYRWPLPSKLCAVWIYLDVLFSTASIMHLCAISLDRYVAIQNP
IHHSRFNSRTKAFLKIIAVWTISVGISMPIPVFGLQDDSKVFKEGSCLLADDNFVLIGSF
VSFFIPLTIMVITYFLTIKSLQKEATLCVSDLGTRAKLASFSFLPQSSLSSEKLFQRSIH
REPGSYTGRRTMQSISNEQKACKVLGIVFFLFVVMWCPFFITNIMAVICKESCNEDVIGA
LLNVFVWIGYLSSAVNPLVYTLFNKTYRSAFSRYIQCQYKENKKPLQLILVNTIPALAYK
SSQLQMGQKKNSKQDAKTTDNDCSMVALGKQHSEEASKDNSDGVNEKVSCV
|
|
|
|---|
| BDBM139370 |
|---|
| n/a |
|---|
| Name | BDBM139370 |
|---|
| Synonyms: | ACP-103 | Nuplazid | Pimavanserin | Pimavanserin hydrochloride | Pimavanserin tartrate | US20230348421, Compound Pimavanserin | WO2023288027, Cmpd PIMA | bis(1-(4-fluorobenzyl)-1-(1-methylpiperidin-4-yl)-3-(4-(2-methylpropoxy)benzyl)urea) (2R,3R)-2,3-dihydroxybutanedioate |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C25H34FN3O2 |
|---|
| Mol. Mass. | 427.5548 |
|---|
| SMILES | CC(C)COc1ccc(CNC(=O)N(Cc2ccc(F)cc2)C2CCN(C)CC2)cc1 |
|---|
| Structure | 
|
|---|
Search and Browse
