| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Interleukin-6 |
|---|
| Ligand | BDBM19190 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | Fluorescence Polarization Ligand Binding Assay |
|---|
| IC50 | 4.2±n/a nM |
|---|
| Citation |  Rucker, PV; Snyder, JS Tricyclic compounds, compositions, and methods US Patent US8901310 Publication Date 12/2/2014 |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Interleukin-6 |
|---|
| Name: | Interleukin-6 |
|---|
| Synonyms: | B-cell stimulatory factor 2 | BSF-2 | CDF | CTL differentiation factor | Hybridoma growth factor | IFN-beta-2 | IFNB2 | IL-6 | IL6 | IL6_HUMAN | Interferon beta-2 |
|---|
| Type: | n/a |
|---|
| Mol. Mass.: | 23717.96 |
|---|
| Organism: | Homo sapiens (Human) |
|---|
| Description: | P05231 |
|---|
| Residue: | 212 |
|---|
| Sequence: | MNSFSTSAFGPVAFSLGLLLVLPAAFPAPVPPGEDSKDVAAPHRQPLTSSERIDKQIRYI
LDGISALRKETCNKSNMCESSKEALAENNLNLPKMAEKDGCFQSGFNEETCLVKIITGLL
EFEVYLEYLQNRFESSEEQARAVQMSTKVLIQFLQKKAKNLDAITTPDPTTNASLLTKLQ
AQNQWLQDMTTHLILRSFKEFLQSSLRALRQM
|
|
|
|---|
| BDBM19190 |
|---|
| n/a |
|---|
| Name | BDBM19190 |
|---|
| Synonyms: | (1S,2R,10S,11S,14R,15S,17S)-14,17-dihydroxy-14-(2-hydroxyacetyl)-2,15-dimethyltetracyclo[8.7.0.0^{2,7}.0^{11,15}]heptadeca-3,6-dien-5-one | CHEMBL131 | Delta-Cortef | Deltacortril | Prednisolone | US10196374, Prednisolone |
|---|
| Type | Steroid |
|---|
| Emp. Form. | C21H28O5 |
|---|
| Mol. Mass. | 360.444 |
|---|
| SMILES | [H][C@@]12CC[C@](O)(C(=O)CO)[C@@]1(C)C[C@H](O)[C@@]1([H])[C@@]2([H])CCC2=CC(=O)C=C[C@]12C |r,c:27,t:23| |
|---|
| Structure | 
|
|---|
Search and Browse
